The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 11

For teachers and parents. Prints separately from the student sheets.

Romans 11 · For teachers and parents

Answer Key: The Depth of the Riches

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod's Olive Tree

scrollwavesseaGiftEye

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGlory to God

GLORY → picture 4TO → picture 3HIM → picture 1FOREVER → picture 2

Grade 1Glory to God

God did not reject his people. → picture 5God keeps his promises. → picture 1God has mercy on all. → picture 4God is very wise. → picture 2Glory to God forever! → picture 3

Grade 2God's Big Olive Tree

  1. Did God turn away from his people? No! (circle)
  2. What is God's family like? An olive tree. (circle)
  3. What can be added to the tree? New branches. (circle)
  4. Who does God have mercy on? All people. (circle)
  5. Who is so wise? God. (circle)
VWWGHBOOLBRERGRLSTRSVARAIRROFLFANVHEKCOTCCEFEESNEEHFYMNMGDMERPMMLEITSKITAAROOTRBK

Grade 3Grafted In

  1. Did God reject his people? No. May it never be!
  2. What is God's family like? An olive tree.
  3. Why should the new branches not boast? Because the root holds them up.
  4. What can never be taken back? The gifts and the calling of God.
  5. Who does God have mercy on? All.
1: I ask then, did God reject his people2: Even so too at this present time also there is a remnant according to the election of grace3: For the gifts and the calling of God are irrevocable4: Oh the depth of the riches both of the wisdom and the knowledge of God
TAGRAFTEDOKUEUASBLELONGERERCIYJAMYLOBRANCHESOGVGRACEGTUTREEVKIVUMBROKENSJKOLIVERB

Grade 4The Gifts and Calling of God

  1. What tribe was Paul from? The tribe of Benjamin.
  2. What is there at this present time? A remnant according to the election of grace.
  3. What supports the grafted branches? The root.
  4. What are irrevocable? The gifts and the calling of God.

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5To Him Be the Glory

  1. How many did God reserve for himself in Elijah's time? Seven thousand.
  2. What has come to the Gentiles? Salvation.
  3. What does Paul remind the grafted branches? It is not you who support the root, but the root supports you.
  4. Why has God bound all to disobedience? That he might have mercy on all.
4BRANCHES3GRFTEDROKEN2GRAE1OLIV

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.