The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 11

Prints on letter paper in black and white. No answers are printed on the student sheet.

Romans 11 · Grade 2

God's Big Olive Tree

Name Date

Read the Story

Paul asked, did God turn away from his people? No! God keeps his promises.

Paul said God's family is like an olive tree. New branches can be added to the tree.

God has mercy on all people. God's gifts never go away.

God is so wise! All things come from him. Glory to God forever!

Memory Verse

“For of him and through him and to him are all things. To him be the glory for ever! Amen.”

Romans 11:36 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Did God turn away from his people?

    New branchesNo!God

  2. What is God's family like?

    GodAn olive treeNo!

  3. What can be added to the tree?

    No!All peopleNew branches

  4. Who does God have mercy on?

    All peopleGodNew branches

  5. Who is so wise?

    An olive treeNew branchesGod

Word Search

Find and circle each word. Words go across and down.

VWWGHBOOLBRERGRLSTRSVARAIRROFLFANVHEKCOTCCEFEESNEEHFYMNMGDMERPMMLEITSKITAAROOTRBK
  • BRANCHES
  • GRAFTED
  • BROKEN
  • LONGER
  • GRACE
  • OLIVE
  • ROOT
  • TREE

Prayer

Dear God, thank You for the lesson of The Depth of the Riches. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why should we not boast?
  • What does grafted in mean?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.