The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 132

For teachers and parents. Prints separately from the student sheets.

Psalms 132 · For teachers and parents

Answer Key: A Place for the Lord

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Chose Zion

crownpeoplelight

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod's Home

ARK → picture 2ZION → picture 4CROWN → picture 1LAMP → picture 3

Grade 1David's Promise

Yahweh, remember David. → picture 2Arise, Yahweh, with the ark. → picture 4We will worship at his footstool. → picture 5Yahweh has chosen Zion. → picture 1I have ordained a lamp for my anointed. → picture 3

Order:

1. Arise, Yahweh, into your resting place2. Let your priests be clothed with righteousness3. For Yahweh has chosen Zion

Grade 2A Home for God

  1. Who does Psalm 132 remember? King David (circle)
  2. What did David want to find? A place for God's house
  3. Where did the people bring the ark? To Jerusalem (circle)
  4. What did God promise David? A child from his family would sit on the throne.
  5. What did God choose as his home? Zion (circle)
ADPRARVUBBERRNFUHHFHECIZIONOBSRAEWGMLRTLERSMCAEIFRHITRMANMTRVSSPDGSYAFEENDAVIDJLG

Grade 3Two Promises

  1. What does the psalm ask God to remember? David
  2. What did David vow? Not to sleep until he found a place for Yahweh
  3. What did the people say they would do? Worship at his footstool
  4. What did Yahweh swear to David? He would set David's son on his throne.
  5. What place did Yahweh choose? Zion
1: Arise, Yahweh, into your resting place2: Let your priests be clothed with righteousness3: For Yahweh has chosen Zion
BMCRWVSGWRLSEMEOVGERESTINGRAPRIESTSHDLUWDAALVFAOVASRZSDMPBVOIITUPMLIESOEJVKTDDENE

Grade 4David's Vow and God's Oath

  1. What event does the psalm recall? David bringing the ark to Jerusalem
  2. What was the ark thought of as? God's footstool on earth
  3. How does the second half differ from the first? It turns from David's vow to God's oath.
  4. Name two things God promises in Zion. Bread for the poor and a lamp for his anointed

Word bank: 1. David; 2. resting; 3. priests; 4. Zion; 5. bread

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Promise to David's Line

  1. What two oaths shape the psalm? David's vow to find a place for Yahweh and God's oath to David
  2. Whose words does Arise, Yahweh echo? Moses' words when the ark set out
  3. What does the horn of David budding picture? God raising up strength in David's line
  4. How does Luke 1:32 connect to Psalm 132? The angel says God will give Mary's son the throne of David.
4DAVID3ZON1BREA2PIESTS5RESTIG

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.