The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 132

Every grade prints starting on a new page. No answers are included.

Psalms 132 · Preschool

God Chose Zion

Name Date

Color the ark and the city. God chose a place to live among his people.

Can you find these in the picture? Circle each one!

Bible Verse

“For Yahweh has chosen Zion. He has desired it for his habitation.”

Psalms 132:13 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God chose a special place to be with his people. Today God is with us when we worship him.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 132 · Kindergarten

God's Home

Name Date

Trace the Words

Trace each word with your pencil.

ARK
ZION
CROWN
LAMP
For Yahweh has chosen Zion. He has desired it for his habitation.

Psalms 132:13 (WEB)

Match the Pictures

Draw a line from each word to its picture.

ARK
ZION
CROWN
LAMP

Mini Maze

Help find the way through the maze.

Draw It

Draw the ark of the covenant.

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did David want to find for God?
  • What did God choose?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 132 · Grade 1

David's Promise

Name Date

Trace the Words

Trace the words and the verse.

DAVID
ARK
ZION
THRONE
For Yahweh has chosen Zion. He has desired it for his habitation.

Psalms 132:13 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Yahweh, remember David.
Arise, Yahweh, with the ark.
We will worship at his footstool.
Yahweh has chosen Zion.
I have ordained a lamp for my anointed.

A Home for God

Write the number 1 to 3 in each circle to show the right order.

For Yahweh has chosen Zion

Arise, Yahweh, into your resting place

Let your priests be clothed with righteousness

Draw the ark of the covenant.

Memory Verse

“For Yahweh has chosen Zion. He has desired it for his habitation.”

Psalms 132:13 (WEB)

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did God promise David?
  • Where do you like to praise God?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 132 · Grade 2

A Home for God

Name Date

Read the Story

Psalm 132 is a Song of Ascents. It remembers King David. David promised he would not rest until he found a place for God's house.

The people brought the ark to Jerusalem. They worshiped God there. God made a promise to David. He said a child from David's family would sit on the throne. God chose Zion as his home.

Memory Verse

“For Yahweh has chosen Zion. He has desired it for his habitation.”

Psalms 132:13 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who does Psalm 132 remember?

    King DavidTo JerusalemA place for God's house

  2. What did David want to find?

  3. Where did the people bring the ark?

    A place for God's houseZionTo Jerusalem

  4. What did God promise David?

  5. What did God choose as his home?

    To JerusalemZionKing David

Word Search

Find and circle each word. Words go across and down.

ADPRARVUBBERRNFUHHFHECIZIONOBSRAEWGMLRTLERSMCAEIFRHITRMANMTRVSSPDGSYAFEENDAVIDJLG
  • RESTING
  • PRIESTS
  • DAVID
  • ARISE
  • BREAD
  • ZION
  • LAMP

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • A promise was made to find a home for God. What promise can you keep this week?
  • What is God's footstool?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 132 · Grade 3

Two Promises

Name Date

Read the Story

Psalm 132 is titled A Song of Ascents. It begins, Yahweh, remember David. David vowed that he would not sleep until he found a place for Yahweh.

The people said, We will go into his dwelling place. We will worship at his footstool. They prayed, Arise, Yahweh, into your resting place, you, and the ark of your strength.

Then the psalm tells God's promise. Yahweh has sworn to David in truth. He would set David's son on his throne. For Yahweh has chosen Zion. This is my resting place forever. He promised to bless it and to make a lamp for his anointed.

Memory Verse

“For Yahweh has chosen Zion. He has desired it for his habitation.”

Psalms 132:13 (WEB)

Answer the Questions

  1. What does the psalm ask God to remember?

  2. What did David vow?

  3. What did the people say they would do?

  4. What did Yahweh swear to David?

  5. What place did Yahweh choose?

A Home for God

Write what happened in each box.

1
2
3

Word Search

Find each word. Words go across, down, and diagonally.

BMCRWVSGWRLSEMEOVGERESTINGRAPRIESTSHDLUWDAALVFAOVASRZSDMPBVOIITUPMLIESOEJVKTDDENE
  • RESTING
  • PRIESTS
  • DAVID
  • ARISE
  • BREAD
  • ZION
  • LAMP

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you make room for God?
  • How can you trust God to keep His word?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 132 · Grade 4

David's Vow and God's Oath

Name Date

Read and Think

Psalm 132 is titled A Song of Ascents and names no author. It recalls the day David brought the ark of the covenant to Jerusalem. The psalm begins, Yahweh, remember David and all his affliction, how he swore to Yahweh. David vowed not to rest until he found out a place for Yahweh, a dwelling for the Mighty One of Jacob.

The people's response follows: We will go into his dwelling place. We will worship at his footstool. The ark was thought of as God's footstool on earth. They pray, Arise, Yahweh, into your resting place, you, and the ark of your strength. Let your priests be clothed with righteousness.

The second half turns from David's vow to God's oath. Yahweh has sworn to David in truth. He will not turn from it: I will set the fruit of your body on your throne. God has chosen Zion: This is my resting place forever. He promises bread for the poor, salvation for the priests, and a lamp for his anointed. The crown on David's heir will shine.

Show What You Know

  1. What event does the psalm recall?

  2. What was the ark thought of as?

  3. How does the second half differ from the first?

  4. Name two things God promises in Zion.

Word Bank Fill-In

Use the word bank to fill in each blank.

ZionbreadrestingpriestsDavid
  1. It recalls the day brought the ark of the covenant to Jerusalem.
  2. They pray, Arise, Yahweh, into your place, you, and the ark of your strength.
  3. Let your be clothed with righteousness.
  4. God has chosen : This is my resting place forever.
  5. He promises for the poor, salvation for the priests, and a lamp for his anointed.

Think About It

  1. David cared deeply about making a place for God. How can you make room for God in your life?

  2. God's oath to David would not change. How does God's faithfulness to his promises encourage you?

Memory Verse

“For Yahweh has chosen Zion. He has desired it for his habitation.”

Psalms 132:13 (WEB)

Copy It

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can you do to make room for God in your home?
  • How can God's promises give you confidence when you fall short?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 132 · Grade 5

The Promise to David's Line

Name Date

Read and Think

Psalm 132 is titled A Song of Ascents and names no author. It is the longest of the Songs of Ascents and is built on two oaths. The first is David's: he swore he would not enter his house, go up into his bed, or give sleep to his eyes until I find out a place for Yahweh. The psalm remembers David's zeal to bring the ark to Jerusalem (2 Samuel 6).

The people relive that journey. They heard of the ark in Ephrathah and found it in the field of Jaar. We will go into his dwelling place. We will worship at his footstool. Their prayer, Arise, Yahweh, into your resting place, echoes the words Moses spoke when the ark set out in the wilderness. They ask for priests clothed with righteousness and saints who shout for joy.

The second oath is God's, and it is greater. Yahweh has sworn to David in truth. He will not turn from it: I will set the fruit of your body on your throne. He chose Zion as his resting place forever and promised to make the horn of David to bud there and to ordain a lamp for his anointed. In the New Testament, the angel tells Mary that God will give her son the throne of his father David (Luke 1:32).

Show What You Know

  1. What two oaths shape the psalm?

  2. Whose words does Arise, Yahweh echo?

  3. What does the horn of David budding picture?

  4. How does Luke 1:32 connect to Psalm 132?

Crossword

43125

Across

  1. I will also clothe her ____ with salvation.
  2. Yahweh has sworn to ____ in truth.
  3. This is my ____ place forever.

Down

  1. I will satisfy her poor with ____.
  2. For Yahweh has chosen ____.

Think About It

  1. God's oath was greater than David's vow. Why is it good news that our hope rests on God's promise more than ours?

  2. David was zealous for God's presence. What would it look like to be zealous for God this week?

Memory Verse

Yahweh has sworn to David in truth. He will not turn from it: “I will set the fruit of your body on your throne.

Psalms 132:11 (WEB)

Copy It

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • God kept His promise to David for many years. How does God's faithfulness to old promises steady you?
  • The priests would be clothed with salvation and the saints would shout for joy. How might God be inviting you to worship with greater joy?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.