The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 132

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 132 · Grade 2

A Home for God

Name Date

Read the Story

Psalm 132 is a Song of Ascents. It remembers King David. David promised he would not rest until he found a place for God's house.

The people brought the ark to Jerusalem. They worshiped God there. God made a promise to David. He said a child from David's family would sit on the throne. God chose Zion as his home.

Memory Verse

“For Yahweh has chosen Zion. He has desired it for his habitation.”

Psalms 132:13 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who does Psalm 132 remember?

    King DavidTo JerusalemA place for God's house

  2. What did David want to find?

  3. Where did the people bring the ark?

    A place for God's houseZionTo Jerusalem

  4. What did God promise David?

  5. What did God choose as his home?

    To JerusalemZionKing David

Word Search

Find and circle each word. Words go across and down.

ADPRARVUBBERRNFUHHFHECIZIONOBSRAEWGMLRTLERSMCAEIFRHITRMANMTRVSSPDGSYAFEENDAVIDJLG
  • RESTING
  • PRIESTS
  • DAVID
  • ARISE
  • BREAD
  • ZION
  • LAMP

Prayer

Dear God, thank You for choosing to dwell with your people. Help me . Amen.

Take It Home

For families: talk about these together.

  • A promise was made to find a home for God. What promise can you keep this week?
  • What is God's footstool?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.