The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 123

For teachers and parents. Prints separately from the student sheets.

Psalms 123 · For teachers and parents

Answer Key: Our Eyes Look to God

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolI Look to God

handpersonheart

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenLook Up

EYES → picture 4LOOK → picture 3MERCY → picture 1HAND → picture 2

Grade 1Our Eyes Look Up

I lift up my eyes to you. → picture 5Servants look to the hand of their master. → picture 1Our eyes look to Yahweh. → picture 4Have mercy on us, Yahweh. → picture 2We have endured much contempt. → picture 3

Order:

1. So our eyes look to Yahweh, our God2. Have mercy on us, Yahweh

Grade 2Looking Up to God

  1. Where does the singer look? Up to God in heaven
  2. What does a servant watch? His master's hand (circle)
  3. Who do God's people look to? God (circle)
  4. What do they ask God to show them? Mercy (circle)
  5. Who had been mean to them? Proud people (circle)
HEAVENSSFGAPHANDEMINAINRNRNMASEYESVTVGYUBLYAGSJFUAKJNMWIGROPATGEPMERCYSKGSGNGMSOE

Grade 3Eyes on the Master

  1. Where does God sit? In the heavens
  2. What does a maid watch? The hand of her mistress
  3. How long will they look to Yahweh? Until he has mercy on them
  4. What have the people endured? Much contempt
  5. Who mocked them? Proud people
1: So our eyes look to Yahweh, our God2: Have mercy on us, Yahweh
OWKKJTRNUHEAVENSNTMRVUMERCYVSERVANTSGVORBCIGMFHVMGLPVEFAFDEYESHMNNKDVMHRLDLOUEWKB

Grade 4Waiting for Mercy

  1. How does the prayer change after verse 1? It moves from one person to the whole people.
  2. Why did servants watch their master's hand? For direction, provision, and help
  3. What do the people ask God for twice? Mercy
  4. How do they respond to the scoffing? They look up and wait for God instead of fighting back.

Word bank: 1. eyes; 2. mercy; 3. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Watching Eyes of Faith

  1. Where does the singer lift up his eyes? To God, who sits in the heavens
  2. What does God's throne in the heavens show? He rules over every situation below.
  3. What attitude does the servant picture show? Dependence and attentive waiting
  4. Which New Testament verse urges believers to look to Jesus? Hebrews 12:2
3MERCY1SRVANTS4HEAENS2EEAND

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.