The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 123

Every grade prints starting on a new page. No answers are included.

Psalms 123 · Preschool

I Look to God

Name Date

Color the person looking up to the sky. We can look to God for help.

Can you find these in the picture? Circle each one!

Bible Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: When we need help, we can ask God for mercy. Let's look up and say, God, please help us!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 123 · Kindergarten

Look Up

Name Date

Trace the Words

Trace each word with your pencil.

EYES
LOOK
MERCY
HAND
Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.

Psalms 123:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

EYES
LOOK
MERCY
HAND

Mini Maze

Help find the way through the maze.

Draw It

Draw eyes looking up to heaven.

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where do we look for help?
  • Where does God sit?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 123 · Grade 1

Our Eyes Look Up

Name Date

Trace the Words

Trace the words and the verse.

EYES
HEAVENS
MERCY
HAND
Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.

Psalms 123:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

I lift up my eyes to you.
Servants look to the hand of their master.
Our eyes look to Yahweh.
Have mercy on us, Yahweh.
We have endured much contempt.

Eyes Up to God

Write the number 1 to 2 in each circle to show the right order.

Have mercy on us, Yahweh

So our eyes look to Yahweh, our God

Draw eyes looking up to heaven.

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • God loves you. How can you look to God?
  • How can you ask God for help?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 123 · Grade 2

Looking Up to God

Name Date

Read the Story

Psalm 123 is a Song of Ascents. The singer looks up to God in heaven.

A servant watches his master's hand. He waits to see what the master wants. In the same way, God's people look to God. They ask God to show them mercy. Proud people had been mean to them. So they looked to God for help.

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where does the singer look?

  2. What does a servant watch?

    GodHis master's handProud people

  3. Who do God's people look to?

    MercyHis master's handGod

  4. What do they ask God to show them?

    Up to God in heavenMercyGod

  5. Who had been mean to them?

    Proud peopleUp to God in heavenGod

Word Search

Find and circle each word. Words go across and down.

HEAVENSSFGAPHANDEMINAINRNRNMASEYESVTVGYUBLYAGSJFUAKJNMWIGROPATGEPMERCYSKGSGNGMSOE
  • SERVANTS
  • HEAVENS
  • MERCY
  • EYES
  • HAND

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • God's people asked Him to be kind. How can you be kind to someone?
  • How can you look to God for help?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 123 · Grade 3

Eyes on the Master

Name Date

Read the Story

Psalm 123 is titled A Song of Ascents. It begins, I lift up my eyes to you, you who sit in the heavens.

Servants watch the hand of their master. A maid watches the hand of her mistress. So our eyes look to Yahweh, our God, until he has mercy on us.

The people pray, Have mercy on us, Yahweh. They have endured much contempt. Proud people mocked them. They bring their hurt to God and wait for his mercy.

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Answer the Questions

  1. Where does God sit?

  2. What does a maid watch?

  3. How long will they look to Yahweh?

  4. What have the people endured?

  5. Who mocked them?

Eyes Up to God

Write what happened in each box.

1
2

Word Search

Find each word. Words go across, down, and diagonally.

OWKKJTRNUHEAVENSNTMRVUMERCYVSERVANTSGVORBCIGMFHVMGLPVEFAFDEYESHMNNKDVMHRLDLOUEWKB
  • SERVANTS
  • HEAVENS
  • MERCY
  • EYES
  • HAND

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep praying when an answer is slow?
  • Who had been unkind to God's people?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 123 · Grade 4

Waiting for Mercy

Name Date

Read and Think

Psalm 123 is titled A Song of Ascents and names no author. It is only four verses long. It begins with one person: I lift up my eyes to you, you who sit in the heavens. Then it becomes the prayer of the whole people.

The central picture comes from a household. Behold, as the eyes of servants look to the hand of their master, as the eyes of a maid to the hand of her mistress, so our eyes look to Yahweh, our God, until he has mercy on us. A servant watched the master's hand for direction, provision, and help. God's people watch him the same way.

Their need is mercy. Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt. Proud people at ease have scoffed at them. They do not fight back with scorn; they look up and wait for God to act.

Show What You Know

  1. How does the prayer change after verse 1?

  2. Why did servants watch their master's hand?

  3. What do the people ask God for twice?

  4. How do they respond to the scoffing?

Word Bank Fill-In

Use the word bank to fill in each blank.

Godeyesmercy
  1. It begins with one person: I lift up my to you, you who sit in the heavens.
  2. Their need is .
  3. They do not fight back with scorn; they look up and wait for to act.

Think About It

  1. The people kept their eyes on God when they were mocked. What can you do when someone makes fun of you?

  2. A servant watches the master's hand. How can you watch for God's direction this week?

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Copy It

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you pray for your church, not just yourself?
  • The people had heard enough scorn from proud people. How can you look to God for guidance at home?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 123 · Grade 5

The Watching Eyes of Faith

Name Date

Read and Think

Psalm 123 is titled A Song of Ascents and names no author. In four verses it moves from I to our. I lift up my eyes to you, you who sit in the heavens. God's throne in the heavens means he rules over every situation below.

The psalm's main picture is a household servant. As the eyes of servants look to the hand of their master, as the eyes of a maid to the hand of her mistress, so our eyes look to Yahweh, our God, until he has mercy on us. Servants watched for a gesture that told them what to do or that offered help. The picture shows dependence and attentive waiting rather than demanding.

The final verses explain the need: they have endured much contempt and are exceedingly filled with the scoffing of those who are at ease, with the contempt of the proud. The comfortable and proud look down on God's people. The response is not revenge but a repeated plea, Have mercy on us, Yahweh, have mercy on us. In the New Testament, Hebrews urges believers to look to Jesus, who endured scorn (Hebrews 12:2).

Show What You Know

  1. Where does the singer lift up his eyes?

  2. What does God's throne in the heavens show?

  3. What attitude does the servant picture show?

  4. Which New Testament verse urges believers to look to Jesus?

Crossword

3142

Across

  1. Until he has ____ on us.
  2. You who sit in the ____.

Down

  1. As the eyes of ____ look to the hand of their master.
  2. I lift up my ____ to you.
  3. As the eyes of servants look to the ____ of their master.

Think About It

  1. The servant's eyes stay on the master's hand. What distracts your eyes from God, and how can you refocus?

  2. God's people answered scorn with prayer, not revenge. How can that shape your response to unkind words?

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Copy It

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does Hebrews 12:2 connect to Psalm 123?
  • How can you respond with prayer when someone mocks your faith?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.