The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 123

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 123 · Grade 3

Eyes on the Master

Name Date

Read the Story

Psalm 123 is titled A Song of Ascents. It begins, I lift up my eyes to you, you who sit in the heavens.

Servants watch the hand of their master. A maid watches the hand of her mistress. So our eyes look to Yahweh, our God, until he has mercy on us.

The people pray, Have mercy on us, Yahweh. They have endured much contempt. Proud people mocked them. They bring their hurt to God and wait for his mercy.

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Answer the Questions

  1. Where does God sit?

  2. What does a maid watch?

  3. How long will they look to Yahweh?

  4. What have the people endured?

  5. Who mocked them?

Eyes Up to God

Write what happened in each box.

1
2

Word Search

Find each word. Words go across, down, and diagonally.

OWKKJTRNUHEAVENSNTMRVUMERCYVSERVANTSGVORBCIGMFHVMGLPVEFAFDEYESHMNNKDVMHRLDLOUEWKB
  • SERVANTS
  • HEAVENS
  • MERCY
  • EYES
  • HAND

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep praying when an answer is slow?
  • Who had been unkind to God's people?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.