The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 123

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 123 · Grade 2

Looking Up to God

Name Date

Read the Story

Psalm 123 is a Song of Ascents. The singer looks up to God in heaven.

A servant watches his master's hand. He waits to see what the master wants. In the same way, God's people look to God. They ask God to show them mercy. Proud people had been mean to them. So they looked to God for help.

Memory Verse

“Have mercy on us, Yahweh, have mercy on us, for we have endured much contempt.”

Psalms 123:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where does the singer look?

  2. What does a servant watch?

    GodHis master's handProud people

  3. Who do God's people look to?

    MercyHis master's handGod

  4. What do they ask God to show them?

    Up to God in heavenMercyGod

  5. Who had been mean to them?

    Proud peopleUp to God in heavenGod

Word Search

Find and circle each word. Words go across and down.

HEAVENSSFGAPHANDEMINAINRNRNMASEYESVTVGYUBLYAGSJFUAKJNMWIGROPATGEPMERCYSKGSGNGMSOE
  • SERVANTS
  • HEAVENS
  • MERCY
  • EYES
  • HAND

Prayer

Dear God, thank You for your mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • God's people asked Him to be kind. How can you be kind to someone?
  • How can you look to God for help?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.