The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 7

For teachers and parents. Prints separately from the student sheets.

Micah 7 · For teachers and parents

Answer Key: Who Is a God Like You?

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Forgives

lightwavessheepheartstaff

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Is My Light

LIGHT → picture 4WAIT → picture 3HEAR → picture 1GOD → picture 2

Grade 1No One Like God

Micah said, I will look to Yahweh. → picture 5Micah said, Yahweh will be a light to me. → picture 1Micah prayed, shepherd your people with your staff. → picture 4He delights in loving kindness. → picture 2He casts our sins into the sea. → picture 3

Order:

1. But as for me, I will look to Yahweh2. When I sit in darkness, Yahweh will be a light to me3. Shepherd your people with your staff4. He will again have compassion on us

Grade 2God Is Like No One Else

  1. Who will Micah look to? Yahweh (circle)
  2. What will Micah do when he falls? Get up (circle)
  3. What will God be in the dark? A light (circle)
  4. What does God love to be? Kind (circle)
  5. Where does God throw our sins? Into the deep sea (circle)
OIDBNDFUGFCLIGHTFFFADSMBACSSTAFFWWFISALVATIONLLCMERCYSSEARDNWLLWOWYOHWFDJAUFLOCKW

Grade 3Waiting for God

  1. What was hard to find? A godly person
  2. Who will Micah wait for? The God of his salvation
  3. What will Yahweh be in the darkness? A light
  4. What does God delight in? Loving kindness
  5. Where will God cast our sins? Into the depths of the sea
1: But as for me, I will look to Yahweh2: When I sit in darkness, Yahweh will be a light to me3: Shepherd your people with your staff4: He will again have compassion on us
SDTNJSINSAAJIKJLFPDMLMERCYYSSLVRFVWWETIFANFHGAAGWLTTFBMFHSFOIBLGFTJYRCOBKRCUFSMKN

Grade 4A God Who Pardons

  1. What picture does Micah use for his sorrow at the start? Someone who finds no grapes after harvest
  2. What three things does Micah say he will do in verse 7? Look to Yahweh, wait for God, and trust that God will hear him
  3. What does Micah admit in verse 9? That he has sinned against God
  4. Why does God not keep his anger forever? Because he delights in loving kindness

Word bank: 1. salvation; 2. God; 3. light; 4. staff; 5. sins

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Who Is a God Like You?

  1. What picture describes the lack of godly people in verse 1? A vineyard after harvest with no cluster of grapes left
  2. How does verse 7 change the direction of the chapter? Micah turns from grief to looking to Yahweh and waiting for God.
  3. How does Micah respond to God's discipline in verse 9? He accepts it because he has sinned, but trusts God will bring him to the light.
  4. Which two images in verse 19 show complete forgiveness? Treading iniquities under foot and casting sins into the depths of the sea
1SIN2SEAALVATION3LGHT

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.