The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 7

Every grade prints starting on a new page. No answers are included.

Micah 7 · Preschool

God Forgives

Name Date

Color the deep blue sea. God throws our sins far away into the sea.

Can you find these in the picture? Circle each one!

Bible Verse

“He will again have compassion on us. He will tread our iniquities under foot. You will cast all their sins into the depths of the sea.”

Micah 7:19 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: When we say sorry to God, he forgives us and throws our sins far away, like into the deep sea!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Micah 7 · Kindergarten

God Is My Light

Name Date

Trace the Words

Trace each word with your pencil.

LIGHT
WAIT
HEAR
GOD
But as for me, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me.

Micah 7:7 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LIGHT
WAIT
HEAR
GOD

Mini Maze

Help find the way through the maze.

Draw It

Draw sins sinking into the deep sea.

Prayer

Dear God, thank You for your mercy and forgiveness. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where does God throw our sins?
  • When do you need to ask God to help you feel brave?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Micah 7 · Grade 1

No One Like God

Name Date

Trace the Words

Trace the words and the verse.

LOOK
WAIT
LIGHT
FORGIVE
But as for me, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me.

Micah 7:7 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Micah said, I will look to Yahweh.
Micah said, Yahweh will be a light to me.
Micah prayed, shepherd your people with your staff.
He delights in loving kindness.
He casts our sins into the sea.

Who Is Like God?

Write the number 1 to 4 in each circle to show the right order.

Shepherd your people with your staff

When I sit in darkness, Yahweh will be a light to me

He will again have compassion on us

But as for me, I will look to Yahweh

Draw sins sinking into the deep sea.

Memory Verse

“But as for me, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me.”

Micah 7:7 (WEB)

Prayer

Dear God, thank You for your mercy and forgiveness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does it feel to be forgiven?
  • How can you share with a friend today?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Micah 7 · Grade 2

God Is Like No One Else

Name Date

Read the Story

Micah was sad. It was hard to find good people. But Micah said, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me.

Micah said, When I fall, I will arise. When I sit in darkness, Yahweh will be a light to me. Micah asked, who is a God like you? God forgives sin. He loves to be kind. He throws all our sins into the deep sea.

Memory Verse

“Who is a God like you, who pardons iniquity, and passes over the disobedience of the remnant of his heritage? He doesn’t retain his anger forever, because he delights in loving kindness.”

Micah 7:18 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who will Micah look to?

    YahwehGet upInto the deep sea

  2. What will Micah do when he falls?

    Get upYahwehKind

  3. What will God be in the dark?

    Get upA lightKind

  4. What does God love to be?

    KindGet upInto the deep sea

  5. Where does God throw our sins?

    Into the deep seaKindYahweh

Word Search

Find and circle each word. Words go across and down.

OIDBNDFUGFCLIGHTFFFADSMBACSSTAFFWWFISALVATIONLLCMERCYSSEARDNWLLWOWYOHWFDJAUFLOCKW
  • SALVATION
  • LIGHT
  • MERCY
  • STAFF
  • FLOCK
  • SINS
  • SEA

Prayer

Dear God, thank You for your mercy and forgiveness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does it feel when someone forgives you?
  • Who can you trust when friends let you down?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Micah 7 · Grade 3

Waiting for God

Name Date

Read the Story

Micah felt like someone looking for fruit after the harvest. He could find no good fruit. It was hard to find a godly person. Even friends and families did not trust each other.

But Micah said, as for me, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me. When I fall, I will arise. When I sit in darkness, Yahweh will be a light to me.

Micah asked God to shepherd his people with his staff. Then he praised God. Who is a God like you? He pardons sin. He delights in loving kindness. He will again have compassion on us. He will cast all our sins into the depths of the sea.

Memory Verse

“Who is a God like you, who pardons iniquity, and passes over the disobedience of the remnant of his heritage? He doesn’t retain his anger forever, because he delights in loving kindness.”

Micah 7:18 (WEB)

Answer the Questions

  1. What was hard to find?

  2. Who will Micah wait for?

  3. What will Yahweh be in the darkness?

  4. What does God delight in?

  5. Where will God cast our sins?

Who Is Like God?

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

SDTNJSINSAAJIKJLFPDMLMERCYYSSLVRFVWWETIFANFHGAAGWLTTFBMFHSFOIBLGFTJYRCOBKRCUFSMKN
  • SALVATION
  • LIGHT
  • MERCY
  • STAFF
  • FLOCK
  • SINS
  • SEA

Prayer

Dear God, thank You for your mercy and forgiveness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you wait for God when things are hard?
  • What does it mean to pardon?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Micah 7 · Grade 4

A God Who Pardons

Name Date

Read and Think

Micah begins with sorrow. He is like someone who comes to the vineyard after harvest and finds no grapes to eat. The godly man has perished out of the earth, he says. Leaders ask for bribes, and even neighbors and family members cannot trust one another.

Then comes a turning point. Micah says, but as for me, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me. Micah tells his enemy not to rejoice and says, when I fall, I will arise. When I sit in darkness, Yahweh will be a light to me. He admits he has sinned, yet he trusts God to bring him out to the light.

Micah prays for God to shepherd his people with his staff, as in the days of old. God promises to show them marvelous things, as when they came out of Egypt. The book ends with praise: who is a God like you, who pardons iniquity? He doesn't keep his anger forever, because he delights in loving kindness. He will tread our iniquities under foot and cast all our sins into the depths of the sea.

Show What You Know

  1. What picture does Micah use for his sorrow at the start?

  2. What three things does Micah say he will do in verse 7?

  3. What does Micah admit in verse 9?

  4. Why does God not keep his anger forever?

Word Bank Fill-In

Use the word bank to fill in each blank.

sinsGodstafflightsalvation
  1. I will wait for the God of my .
  2. My will hear me.
  3. When I sit in darkness, Yahweh will be a to me.
  4. Micah prays for God to shepherd his people with his , as in the days of old.
  5. He will tread our iniquities under foot and cast all our into the depths of the sea.

Think About It

  1. Micah said, when I fall, I will arise. How does God help you get back up after you make a mistake?

  2. God casts our sins into the depths of the sea. How does it feel to know God forgives completely?

Memory Verse

“Who is a God like you, who pardons iniquity, and passes over the disobedience of the remnant of his heritage? He doesn’t retain his anger forever, because he delights in loving kindness.”

Micah 7:18 (WEB)

Copy It

Prayer

Dear God, thank You for your mercy and forgiveness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God guide you like a shepherd?
  • Who could you say sorry to this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Micah 7 · Grade 5

Who Is a God Like You?

Name Date

Read and Think

The last chapter of Micah begins in grief. The prophet compares himself to someone gleaning a vineyard after harvest and finding no cluster of grapes. The godly man has perished out of the earth. Rulers and judges ask for bribes, and trust has broken down even inside households.

In verse 7 Micah turns everything around and says, but as for me, I will look to Yahweh. I will wait for the God of my salvation. My God will hear me. He tells the enemy not to gloat, saying, when I fall, I will arise. When I sit in darkness, Yahweh will be a light to me. He accepts God's discipline because he has sinned against him, yet he is confident God will plead his case and bring him out to the light.

Micah then prays like a shepherd's song: shepherd your people with your staff, the flock of your heritage. God answers with a promise of marvelous things, as in the days of the exodus from Egypt. The book closes with praise: who is a God like you, who pardons iniquity and passes over the disobedience of the remnant of his heritage? He doesn't retain his anger forever, because he delights in loving kindness. He will tread our iniquities under foot and cast all our sins into the depths of the sea, keeping the truth and mercy he swore to Abraham and Jacob.

Show What You Know

  1. What picture describes the lack of godly people in verse 1?

  2. How does verse 7 change the direction of the chapter?

  3. How does Micah respond to God's discipline in verse 9?

  4. Which two images in verse 19 show complete forgiveness?

Crossword

123

Across

  1. You will cast all their ____ into the depths of the sea.
  2. He will bring me out to the ____.

Down

  1. I will wait for the God of my ____.
  2. And from ____ to sea.

Think About It

  1. Micah chose to look to Yahweh when everything around him seemed broken. What helps you keep hope when things go wrong?

  2. Micah's book ends with God's delight in loving kindness. How can God's forgiveness change the way you forgive others?

Memory Verse

“Who is a God like you, who pardons iniquity, and passes over the disobedience of the remnant of his heritage? He doesn’t retain his anger forever, because he delights in loving kindness.”

Micah 7:18 (WEB)

Copy It

Prayer

Dear God, thank You for your mercy and forgiveness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does it feel to know God delights in mercy?
  • How can you thank God for forgiving you?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.