The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 5

For teachers and parents. Prints separately from the student sheets.

Lamentations 5 · For teachers and parents

Answer Key: Remember Us, Lord

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Rules Forever

crownpeopleheartHandsun

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenTurn Us, Lord

KING → picture 3PRAY → picture 1NEW → picture 4LOVE → picture 2

Grade 1Make Us New

The people prayed to God. → picture 4They asked God to see them. → picture 3God is King forever. → picture 1They asked God to turn them back. → picture 5They asked God to make them new. → picture 2

Order:

1. Remember, Yahweh, what has come on us2. The joy of our heart has ceased3. You, Yahweh, remain forever4. Turn us to yourself, Yahweh, and we will be turned

Grade 2A Prayer to God

  1. How did God's people feel? Very sad (circle)
  2. What had they lost? Their homes (circle)
  3. What did they say they had done? They had sinned (circle)
  4. How long is God King? Forever (circle)
  5. What did they ask God to make new? Their days (circle)
PODBFYFJWDAYSLWBWEFREMEMBEROHEPIOKTWRFJLCDTUJEAFDDIORRVCELPEJNYERENEWRDTRTHRONESY

Grade 3Renew Our Days

  1. What is the last chapter of Lamentations? A prayer
  2. Who lived in their homes? Strangers
  3. What did they have to pay for? Water and wood
  4. What did they tell God honestly? That they had sinned
  5. What did they ask God to renew? Their days
1: Remember, Yahweh, what has come on us2: The joy of our heart has ceased3: You, Yahweh, remain forever4: Turn us to yourself, Yahweh, and we will be turned
POFRRNHDRPIOEFSHALCWRMHVTYVIAEENRHSFVNVMYERLTBTEBVNOCNYIREAENFUVTURNWEUJMPELDERSJ

Grade 4Turn Us to Yourself

  1. How many verses does chapter 5 have? Twenty-two
  2. Is chapter 5 an acrostic? No
  3. What did the people have to pay for? Water and wood
  4. What does verse 19 say about God's throne? It is from generation to generation

Word bank: 1. Remember; 2. forever; 3. throne; 4. Turn; 5. Renew

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5An Unfinished Prayer

  1. How does the structure of chapter 5 differ from the earlier acrostics? It has twenty-two lines but does not follow the alphabet's order
  2. What two kinds of sin are confessed? Their fathers' sins and their own
  3. Which verse is the turning point? Verse 19
  4. In Jewish practice, what is often done with verse 21 when reading aloud? Repeats verse 21 after verse 22
3FOREVER1THRNEU2RNENW

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.