The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Every grade prints starting on a new page. No answers are included.

Lamentations 5 · Preschool

God Rules Forever

Name Date

Color the throne and the people praying. God is King forever!

Can you find these in the picture? Circle each one!

Bible Verse

“You, Yahweh, remain forever. Your throne is from generation to generation.”

Lamentations 5:19 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Then explain that God's people were very sad, and they prayed. They remembered that God is King forever. Ask, What would you like to ask God? Pray together, asking God to help you and make you new.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Lamentations 5 · Kindergarten

Turn Us, Lord

Name Date

Trace the Words

Trace each word with your pencil.

TURN
NEW
KING
PRAY
Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.

Lamentations 5:21 (WEB)

Match the Pictures

Draw a line from each word to its picture.

KING
PRAY
NEW
LOVE

Mini Maze

Help find the way through the maze.

Draw It

Draw a throne.

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who is King forever?
  • What can we ask God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Lamentations 5 · Grade 1

Make Us New

Name Date

Trace the Words

Trace the words and the verse.

REMEMBER
TURN
RENEW
FOREVER
Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.

Lamentations 5:21 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The people prayed to God.
They asked God to see them.
God is King forever.
They asked God to turn them back.
They asked God to make them new.

Renew Us

Write the number 1 to 4 in each circle to show the right order.

Turn us to yourself, Yahweh, and we will be turned

The joy of our heart has ceased

Remember, Yahweh, what has come on us

You, Yahweh, remain forever

Draw a throne.

Memory Verse

“Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.”

Lamentations 5:21 (WEB)

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you talk to God when you are sad?
  • What did the people tell God?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Lamentations 5 · Grade 2

A Prayer to God

Name Date

Read the Story

God's people were very sad. They had lost their homes. They prayed to God. They said they had sinned.

They said that God is King forever. They asked God to turn them back to him. They asked him to make their days new again. God hears the prayers of his people.

Memory Verse

“Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.”

Lamentations 5:21 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How did God's people feel?

    Very sadTheir daysThey had sinned

  2. What had they lost?

    Their homesForeverThey had sinned

  3. What did they say they had done?

    They had sinnedForeverTheir homes

  4. How long is God King?

    Very sadTheir homesForever

  5. What did they ask God to make new?

    ForeverThey had sinnedTheir days

Word Search

Find and circle each word. Words go across and down.

PODBFYFJWDAYSLWBWEFREMEMBEROHEPIOKTWRFJLCDTUJEAFDDIORRVCELPEJNYERENEWRDTRTHRONESY
  • REMEMBER
  • FOREVER
  • THRONE
  • ELDERS
  • RENEW
  • TURN
  • DAYS

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why were they sad?
  • What is something you hope God will make new in your life?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Lamentations 5 · Grade 3

Renew Our Days

Name Date

Read the Story

The last chapter of Lamentations is a prayer. The people asked Yahweh to remember what had happened to them. Strangers lived in their homes. They had to pay for water and wood. Their joy had turned into sadness.

They told God honestly that they had sinned. The crown has fallen from our head. Woe to us, for we have sinned!

Then they looked up. You, Yahweh, remain forever. Your throne is from generation to generation. Kings and cities can fall, but God's throne never does. So they prayed: Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.

Memory Verse

“Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.”

Lamentations 5:21 (WEB)

Answer the Questions

  1. What is the last chapter of Lamentations?

  2. Who lived in their homes?

  3. What did they have to pay for?

  4. What did they tell God honestly?

  5. What did they ask God to renew?

Renew Us

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

POFRRNHDRPIOEFSHALCWRMHVTYVIAEENRHSFVNVMYERLTBTEBVNOCNYIREAENFUVTURNWEUJMPELDERSJ
  • REMEMBER
  • FOREVER
  • THRONE
  • ELDERS
  • RENEW
  • TURN
  • DAYS

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did they admit their sin?
  • How long does God rule?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Lamentations 5 · Grade 4

Turn Us to Yourself

Name Date

Read and Think

Lamentations 5 is different from the first four chapters. It has twenty-two verses, like the number of Hebrew letters, but it is not an acrostic. It is a community prayer. Remember, Yahweh, what has come on us. Look, and see our reproach.

The people list their losses: their inheritance had gone to strangers, they had become like orphans, and they had to pay even for water and wood. Joy and music had stopped. They confess both their fathers' sins and their own. The crown has fallen from our head. Woe to us, for we have sinned!

In verse 19 the prayer lifts its eyes to God's eternal rule. You, Yahweh, remain forever. Your throne is from generation to generation. Because God's throne stands, the people can ask him to restore them. Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old. They know that only God can turn their hearts.

Show What You Know

  1. How many verses does chapter 5 have?

  2. Is chapter 5 an acrostic?

  3. What did the people have to pay for?

  4. What does verse 19 say about God's throne?

Word Bank Fill-In

Use the word bank to fill in each blank.

RenewTurnthroneRememberforever
  1. , Yahweh, what has come on us.
  2. You, Yahweh, remain .
  3. Your is from generation to generation.
  4. us to yourself, Yahweh, and we will be turned.
  5. our days as of old.

Think About It

  1. Why do the people ask God to turn them instead of promising to turn themselves?

  2. How can God's eternal rule give hope when everything else seems lost?

Memory Verse

“Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.”

Lamentations 5:21 (WEB)

Copy It

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why ask God to turn us?
  • What would you ask God to renew?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Lamentations 5 · Grade 5

An Unfinished Prayer

Name Date

Read and Think

The final chapter is a communal prayer in twenty-two lines, matching the alphabet's length but not its order, as if the structure itself were breaking down. Remember, Yahweh, what has come on us. Look, and see our reproach. The community lists its losses under foreign rule: land given to strangers, families broken, hard labor, and joy turned to mourning.

The confession is double. Our fathers sinned, and are no more. We have borne their iniquities. Yet a few verses later they admit their own guilt as well. The crown has fallen from our head. Woe to us, for we have sinned! Lament does not shift blame; it tells the whole truth.

The turning point is verse 19. You, Yahweh, remain forever. Your throne is from generation to generation. Because God still reigns, the people dare to ask for help. Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old. The book ends with an honest, unresolved question about whether God has rejected them. In Jewish practice, verse 21 is often repeated after verse 22 when reading aloud, so the reading ends on hope. Christians see the answer in God's later work of restoration and in the new covenant Jeremiah promised.

Show What You Know

  1. How does the structure of chapter 5 differ from the earlier acrostics?

  2. What two kinds of sin are confessed?

  3. Which verse is the turning point?

  4. In Jewish practice, what is often done with verse 21 when reading aloud?

Crossword

312

Across

  1. ____ us to yourself, Yahweh, and we will be turned.
  2. You, Yahweh, remain ____.

Down

  1. Your ____ is from generation to generation.
  2. ____ our days as of old.

Think About It

  1. Why might the Bible allow a book to end with an unresolved question?

  2. How does asking God to turn us show trust in his grace?

Memory Verse

“Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.”

Lamentations 5:21 (WEB)

Copy It

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can God make things new?
  • How could you pray this prayer?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.