The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Prints on letter paper in black and white. No answers are printed on the student sheet.

Lamentations 5 · Grade 3

Renew Our Days

Name Date

Read the Story

The last chapter of Lamentations is a prayer. The people asked Yahweh to remember what had happened to them. Strangers lived in their homes. They had to pay for water and wood. Their joy had turned into sadness.

They told God honestly that they had sinned. The crown has fallen from our head. Woe to us, for we have sinned!

Then they looked up. You, Yahweh, remain forever. Your throne is from generation to generation. Kings and cities can fall, but God's throne never does. So they prayed: Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.

Memory Verse

“Turn us to yourself, Yahweh, and we will be turned. Renew our days as of old.”

Lamentations 5:21 (WEB)

Answer the Questions

  1. What is the last chapter of Lamentations?

  2. Who lived in their homes?

  3. What did they have to pay for?

  4. What did they tell God honestly?

  5. What did they ask God to renew?

Renew Us

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

POFRRNHDRPIOEFSHALCWRMHVTYVIAEENRHSFVNVMYERLTBTEBVNOCNYIREAENFUVTURNWEUJMPELDERSJ
  • REMEMBER
  • FOREVER
  • THRONE
  • ELDERS
  • RENEW
  • TURN
  • DAYS

Prayer

Dear God, thank You for being King forever. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did they admit their sin?
  • How long does God rule?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.