The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 4

For teachers and parents. Prints separately from the student sheets.

Jonah 4 · For teachers and parents

Answer Key: God Cares for Everyone

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Cares for All

plantssunpersoncityheart

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Is Kind

VINE → picture 2SUN → picture 4WORM → picture 1CITY → picture 3

Grade 1Jonah and the Vine

Jonah was angry. → picture 2God is gracious and merciful. → picture 4God made a vine for shade. → picture 5The sun beat on Jonah's head. → picture 1God cared for Nineveh. → picture 3

Order:

1. But it displeased Jonah exceedingly, and he was angry2. I knew that you are a gracious God and merciful3. Yahweh God prepared a vine and made it to come up over Jonah4. Shouldn’t I be concerned for Nineveh, that great city

Grade 2God Cares for Everyone

  1. How did Jonah feel? Angry (circle)
  2. What did God make grow? A vine (circle)
  3. What chewed the vine? A worm (circle)
  4. What beat on Jonah's head? The sun (circle)
  5. Who did God care about? The people of Nineveh and the animals
DRECLOAMPVIHIGRNEOICDTRDGRHTAJYAJRCSOTSHCVYIHTLGTIVMFACJPTOITUDCWJTUNDLEYSDJSENEU

Grade 3Jonah Learns About Mercy

  1. Why was Jonah angry? God showed mercy to Nineveh.
  2. What four things did Jonah say about God? Gracious, merciful, slow to anger, and full of loving kindness
  3. Where did Jonah sit? In a booth east of the city
  4. What made the vine wither? A worm
  5. What did God care about? Nineveh, its people, and its many animals
1: But it displeased Jonah exceedingly, and he was angry2: I knew that you are a gracious God and merciful3: Yahweh God prepared a vine and made it to come up over Jonah4: Shouldn’t I be concerned for Nineveh, that great city
MAYPGMVTSSEAIRMIKAHSRWAYNNNKHWCCREEGAAOCITYNRIDWIOFYSYPECAURUJPWTALSGNLLROIEOGSPB

Grade 4A Lesson from a Vine

  1. Why did Jonah say he fled to Tarshish? He knew God was gracious and merciful and would relent.
  2. What question did Yahweh ask Jonah twice? Is it right for you to be angry?
  3. What three things did God prepare in this chapter? A vine, a worm, and an east wind
  4. How many persons lived in Nineveh, according to verse 11? More than one hundred twenty thousand

Word bank: 1. angry; 2. gracious; 3. city; 4. shade; 5. vine

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5God Asks, Shouldn't I Be Concerned?

  1. What does Jonah reveal in verse 2 about why he fled? He knew God was gracious and merciful and would relent from harm.
  2. What four things did God prepare in the book of Jonah? A fish, a vine, a worm, and an east wind
  3. What comparison does God make in verses 10-11? Jonah cared for a short-lived vine; God cares for a great city of people and animals.
  4. Why is it significant that the book ends with a question? It leaves the reader to answer whether they share God's compassion.
4CITY3VNE2ANGR1GRCIOUS5MRCIFUL

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.