The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 4

Every grade prints starting on a new page. No answers are included.

Jonah 4 · Preschool

God Cares for All

Name Date

Color the vine and the city. God loves all people.

Can you find these in the picture? Circle each one!

Bible Verse

Shouldn’t I be concerned for Nineveh, that great city, in which are more than one hundred twenty thousand persons who can’t discern between their right hand and their left hand, and also many animals?”

Jonah 4:11 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God cared about all the people in the big city and even the animals. God cares about everyone!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jonah 4 · Kindergarten

God Is Kind

Name Date

Trace the Words

Trace each word with your pencil.

VINE
SUN
WORM
CITY
Yahweh said, “Is it right for you to be angry?”

Jonah 4:4 (WEB)

Match the Pictures

Draw a line from each word to its picture.

VINE
SUN
WORM
CITY

Mini Maze

Help find the way through the maze.

Draw It

Draw the vine that gave Jonah shade.

Prayer

Dear God, thank You for your great mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How did Jonah feel when God was kind?
  • How can you thank God for a small gift he gave you today?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jonah 4 · Grade 1

Jonah and the Vine

Name Date

Trace the Words

Trace the words and the verse.

ANGRY
VINE
SHADE
CARE
Yahweh said, “Is it right for you to be angry?”

Jonah 4:4 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Jonah was angry.
God is gracious and merciful.
God made a vine for shade.
The sun beat on Jonah's head.
God cared for Nineveh.

God Cares

Write the number 1 to 4 in each circle to show the right order.

I knew that you are a gracious God and merciful

But it displeased Jonah exceedingly, and he was angry

Yahweh God prepared a vine and made it to come up over Jonah

Shouldn’t I be concerned for Nineveh, that great city

Draw the vine that gave Jonah shade.

Memory Verse

Yahweh said, “Is it right for you to be angry?”

Jonah 4:4 (WEB)

Prayer

Dear God, thank You for your great mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be nice to someone who is hard to like?
  • How can you stop being grumpy when things do not go your way?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jonah 4 · Grade 2

God Cares for Everyone

Name Date

Read the Story

God was kind to Nineveh. But Jonah was angry. He said he knew God is gracious and slow to anger.

Jonah went out of the city and sat down. God made a vine grow over him. It gave Jonah shade. Jonah was glad. But the next day a worm chewed the vine, and it dried up. The hot sun beat on Jonah. God said Jonah cared about the vine. God cared about the people of Nineveh and the animals too.

Memory Verse

He prayed to Yahweh, and said, “Please, Yahweh, wasn’t this what I said when I was still in my own country? Therefore I hurried to flee to Tarshish, for I knew that you are a gracious God and merciful, slow to anger, and abundant in loving kindness, and you relent of doing harm.

Jonah 4:2 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How did Jonah feel?

    AngryA wormThe sun

  2. What did God make grow?

    The sunA wormA vine

  3. What chewed the vine?

    A wormAngryA vine

  4. What beat on Jonah's head?

    AngryA wormThe sun

  5. Who did God care about?

Word Search

Find and circle each word. Words go across and down.

DRECLOAMPVIHIGRNEOICDTRDGRHTAJYAJRCSOTSHCVYIHTLGTIVMFACJPTOITUDCWJTUNDLEYSDJSENEU
  • GRACIOUS
  • MERCIFUL
  • ANGRY
  • SHADE
  • VINE
  • CITY

Prayer

Dear God, thank You for your great mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do you act when someone else gets something good?
  • Who can you be kind to this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jonah 4 · Grade 3

Jonah Learns About Mercy

Name Date

Read the Story

God did not bring the disaster on Nineveh. This made Jonah very angry. He prayed and said he knew God was gracious and merciful, slow to anger, and full of loving kindness. Yahweh asked him, is it right for you to be angry?

Jonah sat in the shade of a booth outside the city. God made a vine grow to shade him, and Jonah was glad.

At dawn God sent a worm, and the vine withered. Jonah was angry about the vine. God said Jonah cared about a vine he did not make grow. Should God not care for Nineveh, with all its people and many animals?

Memory Verse

He prayed to Yahweh, and said, “Please, Yahweh, wasn’t this what I said when I was still in my own country? Therefore I hurried to flee to Tarshish, for I knew that you are a gracious God and merciful, slow to anger, and abundant in loving kindness, and you relent of doing harm.

Jonah 4:2 (WEB)

Answer the Questions

  1. Why was Jonah angry?

  2. What four things did Jonah say about God?

  3. Where did Jonah sit?

  4. What made the vine wither?

  5. What did God care about?

God Cares

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

MAYPGMVTSSEAIRMIKAHSRWAYNNNKHWCCREEGAAOCITYNRIDWIOFYSYPECAURUJPWTALSGNLLROIEOGSPB
  • GRACIOUS
  • MERCIFUL
  • ANGRY
  • SHADE
  • VINE
  • CITY

Prayer

Dear God, thank You for your great mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why does God want to give people who do wrong a second chance?
  • How can you welcome people who are not like you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jonah 4 · Grade 4

A Lesson from a Vine

Name Date

Read and Think

When God spared Nineveh, it displeased Jonah exceedingly, and he was angry. He prayed and said this was why he had fled to Tarshish. He knew Yahweh was a gracious God and merciful, slow to anger, and abundant in loving kindness. Jonah was so upset that he felt he would rather die. Yahweh asked, is it right for you to be angry?

Jonah went out to the east side of the city and made a booth. He sat in its shade to see what would become of Nineveh. Yahweh God prepared a vine to grow over Jonah and shade his head, and Jonah was exceedingly glad because of the vine.

At dawn the next day, God prepared a worm, and it chewed the vine so that it withered. God sent a sultry east wind, and the sun beat on Jonah's head until he was faint. God asked if it was right for him to be angry about the vine. Then God explained: Jonah was concerned for a vine he did not plant. Shouldn't God be concerned for Nineveh, a great city with more than one hundred twenty thousand persons and many animals?

Show What You Know

  1. Why did Jonah say he fled to Tarshish?

  2. What question did Yahweh ask Jonah twice?

  3. What three things did God prepare in this chapter?

  4. How many persons lived in Nineveh, according to verse 11?

Word Bank Fill-In

Use the word bank to fill in each blank.

angryshadegraciouscityvine
  1. When God spared Nineveh, it displeased Jonah exceedingly, and he was .
  2. He knew Yahweh was a God and merciful, slow to anger, and abundant in loving kindness.
  3. Jonah went out to the east side of the and made a booth.
  4. He sat in its to see what would become of Nineveh.
  5. Yahweh God prepared a to grow over Jonah and shade his head, and Jonah was exceedingly glad because of the vine.

Think About It

  1. Jonah cared more about a vine than about people. What helps you care about people who are different from you?

  2. God's question ends the book with no answer from Jonah. How would you answer God's question?

Memory Verse

He prayed to Yahweh, and said, “Please, Yahweh, wasn’t this what I said when I was still in my own country? Therefore I hurried to flee to Tarshish, for I knew that you are a gracious God and merciful, slow to anger, and abundant in loving kindness, and you relent of doing harm.

Jonah 4:2 (WEB)

Copy It

Prayer

Dear God, thank You for your great mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • When have you been upset that God was kind to someone?
  • How do you see God's care in small gifts around you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jonah 4 · Grade 5

God Asks, Shouldn't I Be Concerned?

Name Date

Read and Think

The final chapter reveals Jonah's heart. When God spared Nineveh, it displeased Jonah exceedingly, and he was angry. In his prayer he finally explains why he ran to Tarshish: he knew that Yahweh is a gracious God and merciful, slow to anger, and abundant in loving kindness, and that he relents of doing harm. These words echo how God described himself to Moses. Jonah was so bitter that he asked God to take his life. Yahweh answered with a gentle question: is it right for you to be angry?

Jonah went out to the east side of the city, made a booth, and sat in its shade to see what would become of Nineveh. Yahweh God prepared a vine to shade his head and deliver him from his discomfort, and Jonah was exceedingly glad because of the vine. Then God prepared a worm at dawn, and the vine withered. God prepared a sultry east wind, and the sun beat on Jonah's head until he was faint and again wished to die.

God asked again whether it was right for Jonah to be angry about the vine, and Jonah insisted that he was right to be angry. God then drew the lesson. Jonah had been concerned for a vine he had not labored for, which came up in a night and perished in a night. Shouldn't God be concerned for Nineveh, that great city, with more than one hundred twenty thousand persons who can't discern between their right hand and their left, and also many animals? The book ends with God's question, inviting every reader to share God's compassion.

Show What You Know

  1. What does Jonah reveal in verse 2 about why he fled?

  2. What four things did God prepare in the book of Jonah?

  3. What comparison does God make in verses 10-11?

  4. Why is it significant that the book ends with a question?

Crossword

43215

Across

  1. For I knew that you are a ____ God and merciful.
  2. Until he might see what would become of the ____.
  3. For I knew that you are a gracious God and ____.

Down

  1. Is it right for you to be ____.
  2. So Jonah was exceedingly glad because of the ____.

Think About It

  1. Jonah was glad to receive mercy in chapter 2 but angry when Nineveh received it. Why is it easier to want mercy for ourselves than for others?

  2. God cares about people who seem far from him. Who is someone you can pray for or show kindness to this week?

Memory Verse

He prayed to Yahweh, and said, “Please, Yahweh, wasn’t this what I said when I was still in my own country? Therefore I hurried to flee to Tarshish, for I knew that you are a gracious God and merciful, slow to anger, and abundant in loving kindness, and you relent of doing harm.

Jonah 4:2 (WEB)

Copy It

Prayer

Dear God, thank You for your great mercy. Help me . Amen.

Take It Home

For families: talk about these together.

  • If God asked you his question from verse 11, what would you say?
  • What could you do to make a new kid feel welcome?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.