The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 66

For teachers and parents. Prints separately from the student sheets.

Isaiah 66 · For teachers and parents

Answer Key: As a Mother Comforts

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Comforts Me

ChildHeartpeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenComfort

MOTHER → picture 4COMFORT → picture 3PEACE → picture 2RIVER → picture 1

Grade 1I Will Comfort You

Heaven is my throne. → picture 3Peace like a river. → picture 5As a mother comforts. → picture 2All nations will come. → picture 4They will see my glory. → picture 1

Order:

1. Heaven is my throne, and the earth is my footstool2. For my hand has made all these things3. Behold, I will extend peace to her like a river4. As one whom his mother comforts, so I will comfort you

Grade 2Like a Mother

  1. What is God's throne? Heaven (circle)
  2. What did God make? All things (circle)
  3. Who does God care for? Humble people who listen (circle)
  4. How will God comfort us? Like a mother (circle)
  5. Who would come to worship? People from all nations (circle)
EIKJHLFNBARWTEEHPERROHACYERTIRRVOGAUHVDOEMLCSEERNNFOEKNRFEBORTLYIWNIRYDNTBETNTJRA

Grade 3Peace Like a River

  1. What is God's footstool? The earth
  2. Who does God look to? The one who trembles at his word
  3. What will God extend like a river? Peace
  4. How will God comfort his people? As a mother comforts
  5. Who will come to worship? All flesh
1: Heaven is my throne, and the earth is my footstool2: For my hand has made all these things3: Behold, I will extend peace to her like a river4: As one whom his mother comforts, so I will comfort you
IHVWTOPCUSECOHGENBBAORRLACFHRMDOOCHSRTFYNRESVIHOHEYFATVYRHEAVENEPTCNWRWERKVNKTOSU

Grade 4All Nations Will See My Glory

  1. Which New Testament passage quotes 66:1? Acts 7:49-50
  2. Who does God look to? The poor, contrite, and those who tremble at his word
  3. How does God promise to comfort his people? As a mother comforts
  4. What will the messengers declare? God's glory among the nations

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5From One Sabbath to Another

  1. Which New Testament passage cites 66:1-2? Acts 7:49-50
  2. Which other verses use motherly language for God? Isaiah 42:14 and 49:15
  3. Which vision in chapter 2 does verses 18-23 fulfill? Isaiah 2:2-4, the nations coming to God
  4. Where does Jesus use the image from the final verse? Mark 9:48
4EARTH3TRONE2PACE1WOD5HAVE

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.