The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 66

Every grade prints starting on a new page. No answers are included.

Isaiah 66 · Preschool

God Comforts Me

Name Date

Color the mother hugging her child. God comforts you like a loving mother.

Can you find these in the picture? Circle each one!

Bible Verse

As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: When you are sad, a mom gives you a hug. God says He will comfort us like that! Let's practice saying: God comforts me.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 66 · Kindergarten

Comfort

Name Date

Trace the Words

Trace each word with your pencil.

MOTHER
COMFORT
PEACE
RIVER
As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Match the Pictures

Draw a line from each word to its picture.

MOTHER
COMFORT
PEACE
RIVER

Mini Maze

Help find the way through the maze.

Draw It

Draw a mother comforting her child.

Prayer

Dear God, thank You for comforting me. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God care for you?
  • How can you help someone who is sad?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 66 · Grade 1

I Will Comfort You

Name Date

Trace the Words

Trace the words and the verse.

THRONE
PEACE
COMFORT
GLORY
As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Heaven is my throne.
Peace like a river.
As a mother comforts.
All nations will come.
They will see my glory.

God Comforts

Write the number 1 to 4 in each circle to show the right order.

For my hand has made all these things

As one whom his mother comforts, so I will comfort you

Heaven is my throne, and the earth is my footstool

Behold, I will extend peace to her like a river

Draw a mother comforting her child.

Memory Verse

As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Prayer

Dear God, thank You for comforting me. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you bow to God in your heart?
  • Who can you be kind to today?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 66 · Grade 2

Like a Mother

Name Date

Read the Story

God said heaven is His throne. He made all things. He cares for people who are humble and listen to Him.

God promised to comfort His people like a mother comforts her child. God would bring people from all nations to worship Him.

Memory Verse

As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What is God's throne?

    Like a motherHumble people who listenHeaven

  2. What did God make?

    All thingsPeople from all nationsHumble people who listen

  3. Who does God care for?

    People from all nationsHumble people who listenLike a mother

  4. How will God comfort us?

    Like a motherAll thingsPeople from all nations

  5. Who would come to worship?

    All thingsPeople from all nationsLike a mother

Word Search

Find and circle each word. Words go across and down.

EIKJHLFNBARWTEEHPERROHACYERTIRRVOGAUHVDOEMLCSEERNNFOEKNRFEBORTLYIWNIRYDNTBETNTJRA
  • COMFORT
  • HEAVEN
  • THRONE
  • EARTH
  • PEACE
  • RIVER
  • GLORY
  • WORD

Prayer

Dear God, thank You for comforting me. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is God's footstool?
  • What is like a river?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 66 · Grade 3

Peace Like a River

Name Date

Read the Story

God said, "Heaven is my throne, and the earth is my footstool." God looks to the one "who trembles at my word."

God said, "Behold, I will extend peace to her like a river." "As one whom his mother comforts, so I will comfort you."

God said he would "gather all nations and languages." They "will come, and will see my glory." God said that "all flesh will come to worship before me."

Memory Verse

As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Answer the Questions

  1. What is God's footstool?

  2. Who does God look to?

  3. What will God extend like a river?

  4. How will God comfort his people?

  5. Who will come to worship?

God Comforts

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

IHVWTOPCUSECOHGENBBAORRLACFHRMDOOCHSRTFYNRESVIHOHEYFATVYRHEAVENEPTCNWRWERKVNKTOSU
  • COMFORT
  • HEAVEN
  • THRONE
  • EARTH
  • PEACE
  • RIVER
  • GLORY
  • WORD

Prayer

Dear God, thank You for comforting me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who will see God's glory?
  • God's people would flourish like grass growing in spring. How can you show joy in worshiping God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 66 · Grade 4

All Nations Will See My Glory

Name Date

Read and Think

Isaiah's final chapter begins with God's greatness: "Heaven is my throne, and the earth is my footstool. What kind of house will you build to me?" In the New Testament, Stephen quotes this in Acts 7:49-50. God is not impressed by grand buildings; he looks to the one "who is poor and of a contrite spirit, and who trembles at my word."

God promises a miraculous birth of a nation: "Shall a nation be born at once?" Those who love Jerusalem should rejoice. God says, "Behold, I will extend peace to her like a river." Then he speaks tenderly: "As one whom his mother comforts, so I will comfort you." God also warns that he will judge those who refuse him.

The book ends with a worldwide vision. God will "gather all nations and languages, and they will come, and will see my glory." Messengers will go to far islands "who have not heard my fame," and "declare my glory among the nations." God promises that "the new heavens and the new earth" will remain, and "all flesh will come to worship before me."

Show What You Know

  1. Which New Testament passage quotes 66:1?

  2. Who does God look to?

  3. How does God promise to comfort his people?

  4. What will the messengers declare?

Think About It

  1. God comforts as one whom his mother comforts. How have you experienced God's comfort?

  2. Isaiah ends with all nations worshiping God. How can you help others hear about God's glory?

Memory Verse

As one whom his mother comforts, so I will comfort you. You will be comforted in Jerusalem.”

Isaiah 66:13 (WEB)

Copy It

Prayer

Dear God, thank You for comforting me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where does Stephen quote 66:1?
  • When has God cared for you when you were hurting?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 66 · Grade 5

From One Sabbath to Another

Name Date

Read and Think

Isaiah 66 gathers the book's great themes. Verses 1-2 relativize the temple: "Heaven is my throne, and the earth is my footstool." In the New Testament, Stephen cites this in Acts 7:49-50 to show God is not confined to buildings. God's favor rests on the humble, echoing 57:15. Verses 3-6 condemn worship without obedience, recalling chapter 1, so the book opens and closes on true versus false worship.

Verses 7-14 picture Zion as a mother giving birth instantly, "Shall a nation be born at once?" The maternal imagery then shifts to God himself: "As one whom his mother comforts, so I will comfort you." This is one of several places where Isaiah uses motherly language for God (compare 42:14 and 49:15). Verses 15-17 announce judgment by fire on the rebellious.

Verses 18-23 fulfill the vision of 2:2-4: God gathers "all nations and languages." Survivors become missionaries to distant lands like Tarshish and Javan, and some from the nations even become "priests and Levites." In the New Testament, Paul's mission to the Gentiles (Romans 15:16) reflects this hope. The new heavens and earth "shall remain," and "all flesh will come to worship." The final verse is a sober warning about those who rebel, a picture Jesus used in the New Testament (Mark 9:48).

Show What You Know

  1. Which New Testament passage cites 66:1-2?

  2. Which other verses use motherly language for God?

  3. Which vision in chapter 2 does verses 18-23 fulfill?

  4. Where does Jesus use the image from the final verse?

Crossword

43215

Across

  1. For as the new heavens and the new ____.
  2. ____ is my throne.

Down

  1. And who trembles at my ____.
  2. I will extend ____ to her like a river.
  3. Heaven is my ____.

Think About It

  1. Isaiah begins and ends with true versus false worship. What makes worship real to God?

  2. Some from the nations become priests. How does this show God's plan includes everyone?

Memory Verse

“For as the new heavens and the new earth, which I will make, shall remain before me,” says Yahweh, “so your offspring and your name shall remain.

Isaiah 66:22 (WEB)

Copy It

Prayer

Dear God, thank You for comforting me. Help me . Amen.

Take It Home

For families: talk about these together.

  • How should God's love for every people shape how you view other cultures?
  • How can your worship come from the heart?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.