The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 20

For teachers and parents. Prints separately from the student sheets.

Isaiah 20 · For teachers and parents

Answer Key: Isaiah Walks Barefoot

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolIsaiah Obeyed God

personsandalspeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenObey God

WALK → picture 2SIGN → picture 4TRUST → picture 1OBEY → picture 3

Grade 1A Sign from God

Isaiah walked barefoot. → picture 2He walked for three years. → picture 4It was a sign. → picture 5Do not trust Egypt. → picture 1Trust God. → picture 3

Order:

1. In the year that Tartan came to Ashdod2. They will be dismayed and confounded3. The inhabitants of this coast land will say in that day4. Behold, this is our expectation

Grade 2Isaiah Took Off His Sandals

  1. What did God tell Isaiah to take off? His sandals (circle)
  2. How long did Isaiah walk barefoot? Three years (circle)
  3. What was Isaiah's walk? A sign (circle)
  4. Who were people trusting? Egypt (circle)
  5. Who did God want them to trust? Him (circle)
WONDERJBBASSYRIAHLMFAKSPRIGYVNKEIAEIESDARBKGSAIAFVLYYARGLRABUPIHNSRNCFTAVIIGTUCBH

Grade 3A Sign and a Wonder

  1. What city did the Assyrian army take? Ashdod
  2. What did God tell Isaiah to take off? His sackcloth and his sandals
  3. How long did Isaiah walk barefoot? Three years
  4. Who would lead away people from Egypt and Ethiopia? The king of Assyria
  5. What would the people ask? How will we escape?
1: In the year that Tartan came to Ashdod2: They will be dismayed and confounded3: The inhabitants of this coast land will say in that day4: Behold, this is our expectation
WDFISAIAHPOEEKYSESRDNPGPRGESANDALSYRSOEDEDHPVIYFUERBTAGEMFMMERNNAPNTOBHTTRASSYRIA

Grade 4Don't Trust in Egypt

  1. Who sent Tartan to capture Ashdod? Sargon king of Assyria
  2. What did God tell Isaiah to remove? The sackcloth from his waist and the sandals from his feet
  3. What was Isaiah's three-year walk a sign concerning? Egypt and Ethiopia
  4. How would people who trusted Egypt feel? Dismayed and confounded

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5A Sign and a Wonder

  1. Around what year did Sargon II put down the rebellion at Ashdod? Around 711 BC
  2. Name two other prophets who acted out God's message. Jeremiah wore a yoke (Jeremiah 27) and Ezekiel lay on his side (Ezekiel 4).
  3. What would the king of Assyria do to Egypt and Ethiopia? Lead away the captives of Egypt and the exiles of Ethiopia
  4. What later woe does the closing question point toward? Woe to those who go down to Egypt for help (31:1)
4EGYPT3YAR2ASSRIA1ISIAH5SNDALS

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.