The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 20

Every grade prints starting on a new page. No answers are included.

Isaiah 20 · Preschool

Isaiah Obeyed God

Name Date

Color Isaiah walking barefoot. Isaiah obeyed God and trusted Him.

Can you find these in the picture? Circle each one!

Bible Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: People trusted Egypt to keep them safe, but only God can truly keep us safe. God asked Isaiah to walk barefoot as a sign, and Isaiah did what God said. We can obey God too! Let's practice saying: I will obey God.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 20 · Kindergarten

Obey God

Name Date

Trace the Words

Trace each word with your pencil.

OBEY
WALK
SIGN
TRUST
They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.

Isaiah 20:5 (WEB)

Match the Pictures

Draw a line from each word to its picture.

WALK
SIGN
TRUST
OBEY

Mini Maze

Help find the way through the maze.

Draw It

Draw Isaiah walking barefoot.

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who obeyed God?
  • What did Isaiah take off?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 20 · Grade 1

A Sign from God

Name Date

Trace the Words

Trace the words and the verse.

SANDAL
WALK
SIGN
TRUST
They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.

Isaiah 20:5 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Isaiah walked barefoot.
He walked for three years.
It was a sign.
Do not trust Egypt.
Trust God.

A Living Sign

Write the number 1 to 4 in each circle to show the right order.

They will be dismayed and confounded

The inhabitants of this coast land will say in that day

Behold, this is our expectation

In the year that Tartan came to Ashdod

Draw Isaiah walking barefoot.

Memory Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • What hard thing might God ask you to do?
  • How can you obey God today?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 20 · Grade 2

Isaiah Took Off His Sandals

Name Date

Read the Story

God asked Isaiah to do something unusual. He told Isaiah to take off his sandals. Isaiah obeyed and walked barefoot for three years.

This was a sign. People were trusting Egypt to help them. God wanted them to trust Him instead. Isaiah obeyed God even when it was hard.

Memory Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did God tell Isaiah to take off?

    His sandalsEgyptHim

  2. How long did Isaiah walk barefoot?

    His sandalsHimThree years

  3. What was Isaiah's walk?

    Three yearsEgyptA sign

  4. Who were people trusting?

    EgyptHimHis sandals

  5. Who did God want them to trust?

    Three yearsA signHim

Word Search

Find and circle each word. Words go across and down.

WONDERJBBASSYRIAHLMFAKSPRIGYVNKEIAEIESDARBKGSAIAFVLYYARGLRABUPIHNSRNCFTAVIIGTUCBH
  • SANDALS
  • SERVANT
  • ASSYRIA
  • ISAIAH
  • WONDER
  • EGYPT
  • SIGN
  • YEAR

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • Isaiah obeyed God even when it was hard. When is it hard for you to obey, and how can God help?
  • God used Isaiah's actions to teach a lesson. How can the things you do teach others about God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 20 · Grade 3

A Sign and a Wonder

Name Date

Read the Story

The army of Assyria came to the city of Ashdod and took it. At that time God spoke to Isaiah. He told him to take off his sackcloth and his sandals.

Isaiah did so. He walked barefoot for three years. God called it "a sign and a wonder concerning Egypt and concerning Ethiopia."

God said the king of Assyria would lead away people from Egypt and Ethiopia. People who trusted Egypt would be upset. They would ask, "how will we escape?" Only God can truly save.

Memory Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Answer the Questions

  1. What city did the Assyrian army take?

  2. What did God tell Isaiah to take off?

  3. How long did Isaiah walk barefoot?

  4. Who would lead away people from Egypt and Ethiopia?

  5. What would the people ask?

A Living Sign

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

WDFISAIAHPOEEKYSESRDNPGPRGESANDALSYRSOEDEDHPVIYFUERBTAGEMFMMERNNAPNTOBHTTRASSYRIA
  • SANDALS
  • SERVANT
  • ASSYRIA
  • ISAIAH
  • WONDER
  • EGYPT
  • SIGN
  • YEAR

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who should we trust?
  • When is it hard to obey God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 20 · Grade 4

Don't Trust in Egypt

Name Date

Read and Think

Isaiah 20 is dated to "the year that Tartan came to Ashdod." Sargon king of Assyria sent his commander to capture this city. Many small nations hoped Egypt and Ethiopia would save them from Assyria.

God gave Isaiah a hard assignment: "loosen the sackcloth from off your waist, and take your sandals from off your feet." Isaiah obeyed and walked barefoot for three years. This acted message was "a sign and a wonder concerning Egypt and concerning Ethiopia."

The meaning was clear: the king of Assyria would lead away the captives of Egypt and Ethiopia. Those who looked to Egypt would be "dismayed and confounded." The coastland people would cry, "Behold, this is our expectation." Trusting powerful nations instead of God would leave them with no escape.

Show What You Know

  1. Who sent Tartan to capture Ashdod?

  2. What did God tell Isaiah to remove?

  3. What was Isaiah's three-year walk a sign concerning?

  4. How would people who trusted Egypt feel?

Think About It

  1. Isaiah obeyed a strange and hard command for three years. What is something hard God is asking you to obey?

  2. People trusted Egypt instead of God. What do people today trust for safety, and why is God better?

Memory Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Copy It

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • What city did Assyria capture?
  • Ashdod fell even though it had friends to help. When do you lean on people more than on God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 20 · Grade 5

A Sign and a Wonder

Name Date

Read and Think

Isaiah 20 is one of the few chapters in Isaiah with a historical date: "In the year that Tartan came to Ashdod, when Sargon the king of Assyria sent him." Assyrian records confirm that Sargon II put down a rebellion at Ashdod around 711 BC The rebels had hoped for help from Egypt, which was then ruled by an Ethiopian (Cushite) dynasty.

God commanded Isaiah to "loosen the sackcloth from off your waist, and take your sandals from off your feet," and Isaiah walked barefoot for three years. Prophets often acted out God's message, as Jeremiah wore a yoke (Jeremiah 27) and Ezekiel lay on his side (Ezekiel 4). Isaiah's obedience made him "a sign and a wonder," a living picture of captives being led away.

God explained that "the king of Assyria will lead away the captives of Egypt and the exiles of Ethiopia." Those who had made Egypt their hope would be "dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory." The closing question, "how will we escape?" points back to the theme of Isaiah 30-31: "Woe to those who go down to Egypt for help" (31:1). True safety is found in God alone.

Show What You Know

  1. Around what year did Sargon II put down the rebellion at Ashdod?

  2. Name two other prophets who acted out God's message.

  3. What would the king of Assyria do to Egypt and Ethiopia?

  4. What later woe does the closing question point toward?

Crossword

43215

Across

  1. At that time Yahweh spoke by ____ the son of Amoz.
  2. To the shame of ____.
  3. And take your ____ from off your feet.

Down

  1. When Sargon the king of ____ sent him.
  2. In the ____ that Tartan came to Ashdod.

Think About It

  1. Isaiah's obedience made him a living message. How can your actions show others what it means to trust God?

  2. The coastland people asked, how will we escape? How does the gospel answer that question for people today?

Memory Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Copy It

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • Isaiah obeyed God in a way that made him look foolish. What would it cost you to obey God when others might laugh?
  • Where do people look for safety instead of God?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.