The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 20

Prints on letter paper in black and white. No answers are printed on the student sheet.

Isaiah 20 · Grade 2

Isaiah Took Off His Sandals

Name Date

Read the Story

God asked Isaiah to do something unusual. He told Isaiah to take off his sandals. Isaiah obeyed and walked barefoot for three years.

This was a sign. People were trusting Egypt to help them. God wanted them to trust Him instead. Isaiah obeyed God even when it was hard.

Memory Verse

“They will be dismayed and confounded, because of Ethiopia their expectation, and of Egypt their glory.”

Isaiah 20:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did God tell Isaiah to take off?

    His sandalsEgyptHim

  2. How long did Isaiah walk barefoot?

    His sandalsHimThree years

  3. What was Isaiah's walk?

    Three yearsEgyptA sign

  4. Who were people trusting?

    EgyptHimHis sandals

  5. Who did God want them to trust?

    Three yearsA signHim

Word Search

Find and circle each word. Words go across and down.

WONDERJBBASSYRIAHLMFAKSPRIGYVNKEIAEIESDARBKGSAIAFVLYYARGLRABUPIHNSRNCFTAVIIGTUCBH
  • SANDALS
  • SERVANT
  • ASSYRIA
  • ISAIAH
  • WONDER
  • EGYPT
  • SIGN
  • YEAR

Prayer

Dear God, thank You for speaking through Your servants. Help me . Amen.

Take It Home

For families: talk about these together.

  • Isaiah obeyed God even when it was hard. When is it hard for you to obey, and how can God help?
  • God used Isaiah's actions to teach a lesson. How can the things you do teach others about God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.