The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Prints on letter paper in black and white. No answers are printed on the student sheet.

Colossians 1 · Grade 3

The Image of God

Name Date

Read the Story

The letter opens with the names Paul and Timothy. They wrote to the saints at Colossae. Paul thanked God for their faith in Christ and their love for all believers. They had learned the good news from Epaphras.

Paul prayed for them all the time. He asked God to fill them with knowledge of His will. He prayed they would please the Lord and bear fruit in every good work. God had rescued them from darkness and brought them into the kingdom of His Son.

Paul said Jesus shows us the God we cannot see. All things were made by Him and for Him. He is before all things. He is the head of the church. Through the cross, God made peace.

Memory Verse

“He is before all things, and in him all things are held together.”

Colossians 1:17 (WEB)

Answer the Questions

  1. Who taught the church the good news?

  2. What did Paul ask God to fill them with?

  3. What were they rescued from?

  4. Who is the head of the church?

Christ Above All

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

KDBODYAKITIMAGELIKWFRUITEOJAOFHHEADNFIRSTBORNNNMWLIGHTWESWGHNLEPVPEACETSKCROSSMSP
  • FIRSTBORN
  • IMAGE
  • PEACE
  • FRUIT
  • LIGHT
  • CROSS
  • HEAD
  • BODY

Prayer

Dear God, thank You for Jesus, who holds all things together. Help me . Amen.

Take It Home

For families: talk about these together.

  • What makes you think Jesus is great?
  • How does it feel to belong to Jesus' kingdom?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.