The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 1

For teachers and parents. Prints separately from the student sheets.

Colossians 1 · For teachers and parents

Answer Key: Christ Over All

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolJesus Holds It All

lj and crosspeoplelighttreeheart

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenJesus Made All

MADE → picture 3HOLD → picture 1FRUIT → picture 4PRAY → picture 2

Grade 1Christ Is First

Paul prayed for them. → picture 4Bear fruit in good work. → picture 3All things were made by Him. → picture 1He holds all things together. → picture 5He made peace by the cross. → picture 2

Grade 2Jesus Is Over All

  1. Who wrote to the church at Colossae? Paul and Timothy (circle)
  2. What did Paul thank God for? Their faith and love (circle)
  3. Who made everything? Jesus (circle)
  4. What does Jesus hold together? All things (circle)
BCUGKVRMHOPNHCROSSFIRSTBORNRFHEADBYPNFRUITMREBODYRSSWAIBJCOSLFCKTRLIGHTEIMAGEUYJO

Grade 3The Image of God

  1. Who taught the church the good news? Epaphras
  2. What did Paul ask God to fill them with? Knowledge of His will
  3. What were they rescued from? Darkness
  4. Who is the head of the church? Jesus
1: He is the image of the invisible God, the firstborn of all creation.2: All things have been created through him and for him.3: He is before all things, and in him all things are held together.4: He is the head of the body, the assembly, who is the beginning, the firstborn from the dead, that in all things he might have the preeminence.
KDBODYAKITIMAGELIKWFRUITEOJAOFHHEADNFIRSTBORNNNMWLIGHTWESWGHNLEPVPEACETSKCROSSMSP

Grade 4In Him All Things Hold Together

  1. Who does verse 1 name as the writers? Paul and Timothy
  2. Who taught the Colossians the Good News? Epaphras, a faithful servant of Christ
  3. What do believers have in Christ? Redemption, the forgiveness of sins
  4. What holds all things together? Christ
  5. How did God make peace? Through the blood of His cross

Word bank: 1. God; 2. fruit; 3. good; 4. image; 5. created

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Firstborn of All Creation

  1. Where is the believers' hope laid up? In the heavens
  2. What does Paul ask God to strengthen them for? Endurance with joy
  3. What did the Father deliver believers out of? The power of darkness
  4. What does Paul call Christ in relation to God? The image of the invisible God
  5. What mystery does Paul make known? Christ in you, the hope of glory

Word bank: 1. God; 2. fruit; 3. image; 4. created; 5. head

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.