The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 12

For teachers and parents. Prints separately from the student sheets.

1 Chronicles 12 · For teachers and parents

Answer Key: Helpers Come to David

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolHelpers for David

crownsheepfamilyheartmountain

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenHelpers

PEOPLE → picture 2KING → picture 4BREAD → picture 1JOY → picture 3

Grade 1Come and Help

Many men came to help David. → picture 2Amasai spoke peace to David. → picture 4Some knew what to do. → picture 5They came with one heart. → picture 1There was food and joy. → picture 3

Order:

1. Now these are those who came to David to Ziklag2. Then David received them and made them captains of the band3. For from day to day men came to David to help him, until there was a great army, like God’s army4. They were there with David three days, eating and drinking; for their brothers had supplied provisions for them

Grade 2Day by Day

  1. Who came to help David? Many men (circle)
  2. When did they come? Day by day (circle)
  3. Who spoke peace to David? Amasai (circle)
  4. How did the men come? With one heart (circle)
  5. What was in Israel? Joy (circle)
CMHSHOBVNMAAEVEFCOISPNLYATSGVATAPYRYHPAUASEGTTFFLLISREYKIIONNESPIJEKRWSHUPEDAVIDH

Grade 3A Great Army

  1. Which tribe were some of the first helpers from? Benjamin
  2. Who did the Spirit come on? Amasai
  3. Why did Amasai say peace was with David? Because God helped him
  4. What did the men of Issachar understand? The times
  5. How long did they eat and drink? Three days
1: Now these are those who came to David to Ziklag2: Then David received them and made them captains of the band3: For from day to day men came to David to help him, until there was a great army, like God’s army4: They were there with David three days, eating and drinking; for their brothers had supplied provisions for them
FYHEARTFFJMANASSEHIUGDJFMKRVALORGNOVCAPTAINSDFHELPERSSGMIGHTYENDAVIDBNTJSAULGPBGB

Grade 4One Heart for the King

  1. Where did the first helpers come to David? To Ziklag
  2. What could some Benjamites do with either hand? Shoot arrows and sling stones
  3. What did Amasai say about God? His God helped David.
  4. What did the sons of Issachar understand? The times, to know what Israel ought to do
  5. How did the men come to Hebron? With a perfect heart

Word bank: 1. David; 2. Mighty; 3. Saul; 4. captains; 5. heart

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Understanding the Times

  1. Where did men join David while he hid from Saul? At Ziklag
  2. What were the men of Gad's faces like? The faces of lions
  3. What does Amasai's word show about the helpers? They came by God's prompting.
  4. What did the sons of Issachar know? What Israel ought to do
  5. Who gathered the people around the king? God
3VALOR2CPTAIN5S4MIGHYAUL1DAVD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.