The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 12

Every grade prints starting on a new page. No answers are included.

1 Chronicles 12 · Preschool

Helpers for David

Name Date

Color the helpers coming to David. Count them as you color.

Can you find these in the picture? Circle each one!

Bible Verse

“For from day to day men came to David to help him, until there was a great army, like God’s army.”

1 Chronicles 12:22 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Many people came to help David. We can be good helpers too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 12 · Kindergarten

Helpers

Name Date

Trace the Words

Trace each word with your pencil.

HELP
DAVID
JOY
GOD
For from day to day men came to David to help him, until there was a great army, like God’s army.

1 Chronicles 12:22 (WEB)

Match the Pictures

Draw a line from each word to its picture.

PEOPLE
KING
BREAD
JOY

Mini Maze

Help find the way through the maze.

Draw It

Draw friends helping each other.

Prayer

Dear God, thank You for helpers and friends. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help someone today?
  • What makes you feel joy?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 12 · Grade 1

Come and Help

Name Date

Trace the Words

Trace the words and the verse.

HELP
PEACE
JOY
HEART
For from day to day men came to David to help him, until there was a great army, like God’s army.

1 Chronicles 12:22 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Many men came to help David.
Amasai spoke peace to David.
Some knew what to do.
They came with one heart.
There was food and joy.

Helpers Come to David

Write the number 1 to 4 in each circle to show the right order.

They were there with David three days, eating and drinking; for their brothers had supplied provisions for them

Now these are those who came to David to Ziklag

Then David received them and made them captains of the band

For from day to day men came to David to help him, until there was a great army, like God’s army

Draw friends helping each other.

Memory Verse

“For from day to day men came to David to help him, until there was a great army, like God’s army.”

1 Chronicles 12:22 (WEB)

Prayer

Dear God, thank You for helpers and friends. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who came to help David?
  • Who spoke peace to David?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 12 · Grade 2

Day by Day

Name Date

Read the Story

Many men came to help David. They came from many tribes. More came day by day.

A man named Amasai wished peace to David. God helps you. David was glad.

All the men came with one heart to make David king. They had lots of food. There was joy in Israel.

Memory Verse

“For from day to day men came to David to help him, until there was a great army, like God’s army.”

1 Chronicles 12:22 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who came to help David?

    Day by dayMany menJoy

  2. When did they come?

    JoyWith one heartDay by day

  3. Who spoke peace to David?

    Many menDay by dayAmasai

  4. How did the men come?

    With one heartAmasaiMany men

  5. What was in Israel?

    JoyAmasaiMany men

Word Search

Find and circle each word. Words go across and down.

CMHSHOBVNMAAEVEFCOISPNLYATSGVATAPYRYHPAUASEGTTFFLLISREYKIIONNESPIJEKRWSHUPEDAVIDH
  • CAPTAINS
  • MANASSEH
  • HELPERS
  • MIGHTY
  • DAVID
  • VALOR
  • HEART
  • SAUL

Prayer

Dear God, thank You for helpers and friends. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did the men of Issachar understand?
  • How long did they eat and drink?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 12 · Grade 3

A Great Army

Name Date

Read the Story

Men came to David even before he was king. Some were from Saul's own tribe, Benjamin. They could use bows and slings with the right hand and the left.

The Spirit came on Amasai. He told David that peace was with him and his helpers, because God helped him. David made them captains.

At Hebron, men from every tribe came to make David king. The men of Issachar understood the times. They all came with one heart. They ate and drank for three days, and there was joy in Israel.

Memory Verse

“For from day to day men came to David to help him, until there was a great army, like God’s army.”

1 Chronicles 12:22 (WEB)

Answer the Questions

  1. Which tribe were some of the first helpers from?

  2. Who did the Spirit come on?

  3. Why did Amasai say peace was with David?

  4. What did the men of Issachar understand?

  5. How long did they eat and drink?

Helpers Come to David

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

FYHEARTFFJMANASSEHIUGDJFMKRVALORGNOVCAPTAINSDFHELPERSSGMIGHTYENDAVIDBNTJSAULGPBGB
  • CAPTAINS
  • MANASSEH
  • HELPERS
  • MIGHTY
  • DAVID
  • VALOR
  • HEART
  • SAUL

Prayer

Dear God, thank You for helpers and friends. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does it mean to come with one heart?
  • How did God help David?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 12 · Grade 4

One Heart for the King

Name Date

Read and Think

Chapter 12 goes back in time to show who helped David before he was king. Mighty men came to him at Ziklag. Some were relatives of Saul from Benjamin, who could shoot arrows and sling stones with either hand. Others from Gad were as swift as gazelles.

When men from Benjamin and Judah came to the stronghold, David asked if they came in peace. Then the Spirit came on Amasai. He said they were David's, that peace was to him and his helpers, for his God helped him (12:18). David received them and made them captains.

Later, armed men from every tribe came to Hebron to turn Saul's kingdom to David. The sons of Issachar had understanding of the times, to know what Israel ought to do. They all came with a perfect heart. For three days they ate and drank, and there was joy in Israel.

Show What You Know

  1. Where did the first helpers come to David?

  2. What could some Benjamites do with either hand?

  3. What did Amasai say about God?

  4. What did the sons of Issachar understand?

  5. How did the men come to Hebron?

Word Bank Fill-In

Use the word bank to fill in each blank.

captainsheartSaulDavidMighty
  1. Chapter 12 goes back in time to show who helped before he was king.
  2. men came to him at Ziklag.
  3. Some were relatives of from Benjamin, who could shoot arrows and sling stones with either hand.
  4. David received them and made them .
  5. They all came with a perfect .

Think About It

  1. The men of Issachar understood the times and knew what to do. How can you ask God for wisdom about what to do?

  2. Many tribes came together with one heart. How can you help your church family work together?

Memory Verse

“Then the Spirit came on Amasai, who was chief of the thirty, and he said, “We are yours, David, and on your side, you son of Jesse. Peace, peace be to you, and peace be to your helpers; for your God helps you.” Then David received them and made them captains of the band.”

1 Chronicles 12:18 (WEB)

Copy It

Prayer

Dear God, thank You for helpers and friends. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did men join David before he was king?
  • How can God's Word help you understand your times?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 12 · Grade 5

Understanding the Times

Name Date

Read and Think

This chapter steps back to David's years as a fugitive. Even while he was hiding from Saul, mighty men joined him at Ziklag. Some came from Saul's own tribe, Benjamin, and others crossed the Jordan from Gad, men whose faces were like the faces of lions. From day to day men came to help him, until there was a great army, like God's army (12:22).

When some from Benjamin and Judah came, David tested their loyalty. The Spirit came on Amasai, who declared that they belonged to David. He spoke peace to David and his helpers, because his God helped him. Here the Chronicler shows that the helpers came by God's prompting, not only by their own choice.

The second list counts the armed men who came to Hebron to make David king. The sons of Issachar had understanding of the times, to know what Israel ought to do. Every group came with a perfect heart. Their brothers supplied food, and there was joy in Israel. God gathered his people around the king he had chosen.

Show What You Know

  1. Where did men join David while he hid from Saul?

  2. What were the men of Gad's faces like?

  3. What does Amasai's word show about the helpers?

  4. What did the sons of Issachar know?

  5. Who gathered the people around the king?

Crossword

32541

Across

  1. Mighty men of ____ for the war
  2. They were among the ____ men
  3. They were of ____’s relatives of the tribe of Benjamin

Down

  1. Some Gadites joined ____ in the stronghold in the wilderness
  2. ____ of thousands who were of Manasseh

Think About It

  1. Men joined David while he was still hiding, before he had a crown. In the New Testament, Jesus calls us to follow Him (Mark 1:17). How can you follow Him faithfully even when it is not popular?

  2. The sons of Issachar understood the times. How can God's Word help you know what to do in your own day?

Memory Verse

“Of the children of Issachar, men who had understanding of the times, to know what Israel ought to do, their heads were two hundred; and all their brothers were at their command.”

1 Chronicles 12:32 (WEB)

Copy It

Prayer

Dear God, thank You for helpers and friends. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help your church work together?
  • How can you follow Jesus when it is hard?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.