The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 12

For teachers and parents. Prints separately from the student sheets.

Zechariah 12 · For teachers and parents

Answer Key: A Spirit of Grace

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Is My Strength

peoplehearthousehand

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Makes Me Strong

STRONG → picture 2GRACE → picture 4PRAY → picture 1GOD → picture 3

Grade 1Grace and Prayer

God stretches out the heavens. → picture 2Yahweh is our strength. → picture 4God will defend Jerusalem. → picture 5A spirit of grace. → picture 1They will pray and mourn. → picture 3

Order:

1. Yahweh, who stretches out the heavens and lays the foundation of the earth2. The chieftains of Judah will say in their heart3. In that day Yahweh will defend the inhabitants of Jerusalem4. The spirit of grace and of supplication

Grade 2God Is Our Strength

  1. Who made the sky? God (circle)
  2. What will God keep safe? Jerusalem (circle)
  3. Who will be strong? Even weak people (circle)
  4. What did the leaders say? God is our strength (circle)
  5. What is grace? A gift we do not earn
CDAVIDNWHMAJVOOOEMWOVASIGOIROUNRUGICFANREARTHSTRENGTHUHEAVENSMELFGRACEYELIMPFOOBS

Grade 3The Spirit of Grace

  1. What does Yahweh stretch out? The heavens
  2. What does God form? The spirit of man
  3. Who will the feeble be like? David
  4. What spirit will God pour out? The spirit of grace and of prayer
  5. How will they mourn? Like someone mourns for an only son
1: Yahweh, who stretches out the heavens and lays the foundation of the earth2: The chieftains of Judah will say in their heart3: In that day Yahweh will defend the inhabitants of Jerusalem4: The spirit of grace and of supplication
HOLMOURNKSEDENOFLEATAAAULLOBERVVRTHFRGGEEITKGVSRDNNDHHYEAWHGSWSCECTPLTJLVFEERDDHP

Grade 4They Will Look to Me

  1. How does verse 1 describe Yahweh? He stretches out the heavens, lays the foundation of the earth, and forms the spirit of man.
  2. Who will be like David? He who is feeble among them
  3. What will God pour out in verse 10? The spirit of grace and of supplication
  4. Where does the New Testament quote verse 10? John 19:37

Word bank: 1. heavens; 2. God; 3. strength; 4. David; 5. mourn

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Spirit of Grace and of Supplication

  1. Why does verse 1 describe Yahweh as Creator? To show the God who made the universe is the one who will act for his people
  2. What does the feeble becoming like David show? God's protection makes even the weakest strong.
  3. What does God's spirit of grace lead the people to do? Look to the one they pierced and mourn
  4. Which two New Testament books use verse 10? John and Revelation
3EART4H1STRNGTH2MOUNEAVENS5DAID

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.