The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 12

Every grade prints starting on a new page. No answers are included.

Zechariah 12 · Preschool

God Is My Strength

Name Date

Color the people praying. God gives his people grace!

Can you find these in the picture? Circle each one!

Bible Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God's people knew God is their strength! God makes even weak people strong.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Zechariah 12 · Kindergarten

God Makes Me Strong

Name Date

Trace the Words

Trace each word with your pencil.

STRONG
GRACE
PRAY
GOD
The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’

Zechariah 12:5 (WEB)

Match the Pictures

Draw a line from each word to its picture.

STRONG
GRACE
PRAY
GOD

Mini Maze

Help find the way through the maze.

Draw It

Draw people praying to God.

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you thank God for the things he made?
  • When you feel weak, how can you ask God for strength?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Zechariah 12 · Grade 1

Grace and Prayer

Name Date

Trace the Words

Trace the words and the verse.

HEAVENS
STRENGTH
GRACE
MOURN
The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’

Zechariah 12:5 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God stretches out the heavens.
Yahweh is our strength.
God will defend Jerusalem.
A spirit of grace.
They will pray and mourn.

A Spirit of Grace

Write the number 1 to 4 in each circle to show the right order.

In that day Yahweh will defend the inhabitants of Jerusalem

The chieftains of Judah will say in their heart

The spirit of grace and of supplication

Yahweh, who stretches out the heavens and lays the foundation of the earth

Draw people praying to God.

Memory Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be gentle with others?
  • How can you tell God you are sorry?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Zechariah 12 · Grade 2

God Is Our Strength

Name Date

Read the Story

God made the sky. He made the earth. He made each person's spirit.

God said he would keep Jerusalem safe. Even weak people will be strong. The leaders said God was their strength. God gives his people grace. Grace is a gift we do not earn. Then the people will pray to God and be sorry for wrong.

Memory Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who made the sky?

    GodGod is our strengthJerusalem

  2. What will God keep safe?

    GodA gift we do not earnJerusalem

  3. Who will be strong?

    Even weak peopleJerusalemA gift we do not earn

  4. What did the leaders say?

    A gift we do not earnEven weak peopleGod is our strength

  5. What is grace?

Word Search

Find and circle each word. Words go across and down.

CDAVIDNWHMAJVOOOEMWOVASIGOIROUNRUGICFANREARTHSTRENGTHUHEAVENSMELFGRACEYELIMPFOOBS
  • STRENGTH
  • HEAVENS
  • EARTH
  • GRACE
  • DAVID
  • MOURN

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you show God you are thankful today?
  • When do you need God's power to keep going?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Zechariah 12 · Grade 3

The Spirit of Grace

Name Date

Read the Story

This revelation comes from Yahweh, who stretches out the heavens. He lays the foundation of the earth and forms the spirit of man.

God promised to defend Jerusalem. The leaders of Judah will say, The inhabitants of Jerusalem are my strength in Yahweh of Armies their God. He who is feeble among them will be like David.

God said he would pour on David's house the spirit of grace and of prayer. God said, they will look to me whom they have pierced. They will mourn for him like someone mourns for an only son. Every family will mourn.

Memory Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Answer the Questions

  1. What does Yahweh stretch out?

  2. What does God form?

  3. Who will the feeble be like?

  4. What spirit will God pour out?

  5. How will they mourn?

A Spirit of Grace

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

HOLMOURNKSEDENOFLEATAAAULLOBERVVRTHFRGGEEITKGVSRDNNDHHYEAWHGSWSCECTPLTJLVFEERDDHP
  • STRENGTH
  • HEAVENS
  • EARTH
  • GRACE
  • DAVID
  • MOURN

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can you do when you feel sorry for something wrong?
  • Who could you forgive this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Zechariah 12 · Grade 4

They Will Look to Me

Name Date

Read and Think

Zechariah 12 is introduced as a revelation of Yahweh's word concerning Israel. It comes from Yahweh. He stretches out the heavens and lays the foundation of the earth. He forms the spirit of man. The Creator is the one who speaks.

God says that in that day he will make Jerusalem like a heavy stone for the nations, and he will defend the people of Jerusalem. The chieftains of Judah will say, the inhabitants of Jerusalem are my strength in Yahweh of Armies their God. He who is feeble among them will be like David.

Then God says, I will pour on David's house and on the inhabitants of Jerusalem the spirit of grace and of supplication. They will look to me whom they have pierced; and they shall mourn for him as one mourns for his only son. In the New Testament, John 19:37 quotes this verse when Jesus is pierced on the cross.

Show What You Know

  1. How does verse 1 describe Yahweh?

  2. Who will be like David?

  3. What will God pour out in verse 10?

  4. Where does the New Testament quote verse 10?

Word Bank Fill-In

Use the word bank to fill in each blank.

GodstrengthmournDavidheavens
  1. He stretches out the and lays the foundation of the earth.
  2. says that in that day he will make Jerusalem like a heavy stone for the nations, and he will defend the people of Jerusalem.
  3. The chieftains of Judah will say, the inhabitants of Jerusalem are my in Yahweh of Armies their God.
  4. He who is feeble among them will be like .
  5. They will look to me whom they have pierced; and they shall for him as one mourns for his only son.

Think About It

  1. God makes even the feeble strong. When have you needed God to be your strength?

  2. Grace leads the people to prayer and sorrow for sin. How does God's kindness lead us to turn to him?

Memory Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Copy It

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does knowing God made everything help you trust him with small things?
  • What helps you say sorry to God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Zechariah 12 · Grade 5

The Spirit of Grace and of Supplication

Name Date

Read and Think

Zechariah 12 opens with a heading: a revelation of Yahweh's word concerning Israel. It names the speaker as Yahweh, who stretches out the heavens and lays the foundation of the earth, and forms the spirit of man within him. The God who made the universe is the God who will act for his people.

The chapter describes a day when nations gather against Jerusalem, but God makes the city a burdensome stone for all who try to lift it. The focus is God's protection: in that day Yahweh will defend the inhabitants of Jerusalem. He who is feeble among them will be like David, and David's house will be like God. The chieftains of Judah recognize where their strength comes from: the inhabitants of Jerusalem are my strength in Yahweh of Armies their God.

Then the chapter turns from victory to repentance. God says, I will pour on David's house and on the inhabitants of Jerusalem the spirit of grace and of supplication. They will look to me whom they have pierced; and they shall mourn for him as one mourns for his only son. The mourning spreads through every family, each one apart. God's grace leads not to pride but to deep sorrow and prayer. In the New Testament, John 19:37 quotes this verse at the cross, and Revelation 1:7 says every eye will see him, including those who pierced him.

Show What You Know

  1. Why does verse 1 describe Yahweh as Creator?

  2. What does the feeble becoming like David show?

  3. What does God's spirit of grace lead the people to do?

  4. Which two New Testament books use verse 10?

Crossword

34125

Across

  1. Who stretches out the heavens and lays the foundation of the ____.
  2. He who is feeble among them at that day will be like ____.

Down

  1. The inhabitants of Jerusalem are my ____ in Yahweh of Armies their God.
  2. The land will ____.
  3. Who stretches out the ____ and lays the foundation of the earth.

Think About It

  1. God's grace led the people to mourn over sin. Why does knowing God's grace make us want to turn from wrong?

  2. In the New Testament, John 19:37 quotes verse 10 at the cross. How does Jesus's death show God's grace to you?

Memory Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Copy It

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do you feel when you think about how much God forgives?
  • Who can you show grace to this week?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.