The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 12

Prints on letter paper in black and white. No answers are printed on the student sheet.

Zechariah 12 · Grade 3

The Spirit of Grace

Name Date

Read the Story

This revelation comes from Yahweh, who stretches out the heavens. He lays the foundation of the earth and forms the spirit of man.

God promised to defend Jerusalem. The leaders of Judah will say, The inhabitants of Jerusalem are my strength in Yahweh of Armies their God. He who is feeble among them will be like David.

God said he would pour on David's house the spirit of grace and of prayer. God said, they will look to me whom they have pierced. They will mourn for him like someone mourns for an only son. Every family will mourn.

Memory Verse

“The chieftains of Judah will say in their heart, ‘The inhabitants of Jerusalem are my strength in Yahweh of Armies their God.’”

Zechariah 12:5 (WEB)

Answer the Questions

  1. What does Yahweh stretch out?

  2. What does God form?

  3. Who will the feeble be like?

  4. What spirit will God pour out?

  5. How will they mourn?

A Spirit of Grace

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

HOLMOURNKSEDENOFLEATAAAULLOBERVVRTHFRGGEEITKGVSRDNNDHHYEAWHGSWSCECTPLTJLVFEERDDHP
  • STRENGTH
  • HEAVENS
  • EARTH
  • GRACE
  • DAVID
  • MOURN

Prayer

Dear God, thank You for your grace. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can you do when you feel sorry for something wrong?
  • Who could you forgive this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.