The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 98

For teachers and parents. Prints separately from the student sheets.

Psalms 98 · For teachers and parents

Answer Key: A Joyful Noise

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolClap and Sing

mountainpeopletrumpetsun

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenJoyful Noise

SING → picture 4HORN → picture 3TRUMPET → picture 2RIVERS → picture 1

Grade 1Make a Joyful Noise

Sing a new song. → picture 3Blow the ram's horn. → picture 5Blow the trumpets. → picture 2Let the rivers clap. → picture 4Let the mountains sing. → picture 1

Order:

1. His right hand and his holy arm have worked salvation for him2. Make a joyful noise to Yahweh3. With trumpets and sound of the ram’s horn4. Let the mountains sing for joy together

Grade 2Clap Your Hands

  1. What kind of song do we sing? A new song (circle)
  2. Who has seen God save? All the earth (circle)
  3. What kind of noise do we make? A happy noise (circle)
  4. What do the rivers do? Clap their hands (circle)
  5. What do the mountains do? Sing for joy (circle)
MTBPSUALKOSRIGITBNUCOUAHNAENRLNMGAGWTCIAGPDRRAVAVPWERPIPYREKKTCNWWBIRYHSSWTJKLSIL

Grade 3All the Earth Has Seen

  1. Why should we sing a new song? He has done marvelous things.
  2. What has worked salvation? His right hand and his holy arm
  3. Who has seen the salvation of God? All the ends of the earth
  4. What instruments are named? The harp, trumpets and the ram's horn
  5. What do the rivers do? Clap their hands
1: His right hand and his holy arm have worked salvation for him2: Make a joyful noise to Yahweh3: With trumpets and sound of the ram’s horn4: Let the mountains sing for joy together
MTCRJLBCFBORLICIDKUYUUAVVHAGVYNMPEABVESYTPKRPUNNOUAEPSDIEPNEITKLLKWDGONSMCSINGHTS

Grade 4The Whole World Rejoices

  1. Who won the victory at the start of the psalm? God himself, with his right hand and holy arm
  2. Who has seen God's salvation? All the ends of the earth
  3. What promises did God remember? His loving kindness and faithfulness toward Israel
  4. How does creation join the festival? The sea roars, rivers clap and mountains sing.

Word bank: 1. God; 2. rivers; 3. sing

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5He Comes to Judge the Earth

  1. How is Psalm 98 related to Psalm 96? Both begin with a new song and end with God coming to judge.
  2. What event does the right hand and holy arm recall? God's rescue of Israel at the Red Sea
  3. How did God's faithfulness to Israel affect the world? All the ends of the earth have seen God's salvation.
  4. What are the three circles of praise? Israel's orchestra, the whole earth, and creation itself
3TRUMPET4S2NWONG5SIN1HAP

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.