The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 98

Every grade prints starting on a new page. No answers are included.

Psalms 98 · Preschool

Clap and Sing

Name Date

Color the rivers and the mountains. They clap and sing for God!

Can you find these in the picture? Circle each one!

Bible Verse

“Let the rivers clap their hands. Let the mountains sing for joy together.”

Psalms 98:8 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: The rivers clap their hands and the mountains sing! Let's clap our hands for God too!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 98 · Kindergarten

Joyful Noise

Name Date

Trace the Words

Trace each word with your pencil.

SING
CLAP
HORN
JOY
Make a joyful noise to Yahweh, all the earth! Burst out and sing for joy, yes, sing praises!

Psalms 98:4 (WEB)

Match the Pictures

Draw a line from each word to its picture.

SING
HORN
TRUMPET
RIVERS

Mini Maze

Help find the way through the maze.

Draw It

Draw rivers clapping and mountains singing.

Prayer

Dear God, thank You for your marvelous things. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you make a happy noise for God?
  • How can you clap your hands for God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 98 · Grade 1

Make a Joyful Noise

Name Date

Trace the Words

Trace the words and the verse.

NEW
SONG
CLAP
JOY
Make a joyful noise to Yahweh, all the earth! Burst out and sing for joy, yes, sing praises!

Psalms 98:4 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Sing a new song.
Blow the ram's horn.
Blow the trumpets.
Let the rivers clap.
Let the mountains sing.

A Joyful Noise

Write the number 1 to 4 in each circle to show the right order.

Let the mountains sing for joy together

His right hand and his holy arm have worked salvation for him

With trumpets and sound of the ram’s horn

Make a joyful noise to Yahweh

Draw rivers clapping and mountains singing.

Memory Verse

“Make a joyful noise to Yahweh, all the earth! Burst out and sing for joy, yes, sing praises!”

Psalms 98:4 (WEB)

Prayer

Dear God, thank You for your marvelous things. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you make a joyful noise to God?
  • What instruments are played?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 98 · Grade 2

Clap Your Hands

Name Date

Read the Story

Sing a new song to God! He did great things. He saved his people. All the earth has seen it.

Make a happy noise to God! Play the harp. Blow the horn. Let the sea roar. Let the rivers clap their hands. Let the mountains sing for joy.

Memory Verse

“Make a joyful noise to Yahweh, all the earth! Burst out and sing for joy, yes, sing praises!”

Psalms 98:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What kind of song do we sing?

    All the earthA new songClap their hands

  2. Who has seen God save?

    A new songSing for joyAll the earth

  3. What kind of noise do we make?

    Sing for joyA new songA happy noise

  4. What do the rivers do?

    A happy noiseA new songClap their hands

  5. What do the mountains do?

    A happy noiseClap their handsSing for joy

Word Search

Find and circle each word. Words go across and down.

MTBPSUALKOSRIGITBNUCOUAHNAENRLNMGAGWTCIAGPDRRAVAVPWERPIPYREKKTCNWWBIRYHSSWTJKLSIL
  • MOUNTAINS
  • TRUMPETS
  • RIVERS
  • SING
  • SONG
  • HARP
  • CLAP
  • NEW

Prayer

Dear God, thank You for your marvelous things. Help me . Amen.

Take It Home

For families: talk about these together.

  • God has done wonderful things. What wonderful thing can you tell a friend about?
  • How can you celebrate what God has done?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 98 · Grade 3

All the Earth Has Seen

Name Date

Read the Story

Psalm 98 is titled A Psalm. Sing to Yahweh a new song, for he has done marvelous things! His right hand and his holy arm have worked salvation for him.

Yahweh has made known his salvation. He has remembered his loving kindness and his faithfulness toward the house of Israel. All the ends of the earth have seen the salvation of our God.

Make a joyful noise to Yahweh, all the earth! Sing praises with the harp. With trumpets and sound of the ram's horn, make a joyful noise before the King. Let the rivers clap their hands. Let the mountains sing for joy together.

Memory Verse

“Yahweh has made known his salvation. He has openly shown his righteousness in the sight of the nations.”

Psalms 98:2 (WEB)

Answer the Questions

  1. Why should we sing a new song?

  2. What has worked salvation?

  3. Who has seen the salvation of God?

  4. What instruments are named?

  5. What do the rivers do?

A Joyful Noise

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

MTCRJLBCFBORLICIDKUYUUAVVHAGVYNMPEABVESYTPKRPUNNOUAEPSDIEPNEITKLLKWDGONSMCSINGHTS
  • MOUNTAINS
  • TRUMPETS
  • RIVERS
  • SING
  • SONG
  • HARP
  • CLAP
  • NEW

Prayer

Dear God, thank You for your marvelous things. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is God's salvation public?
  • How is this psalm like Psalm 96?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 98 · Grade 4

The Whole World Rejoices

Name Date

Read and Think

Psalm 98 is titled simply A Psalm, and it does not name its writer. It begins with God's victory: Sing to Yahweh a new song, for he has done marvelous things! His right hand and his holy arm have worked salvation for him. God himself won the victory.

God's salvation was not hidden. Yahweh has made known his salvation. He has openly shown his righteousness in the sight of the nations. He kept his promises to Israel: he has remembered his loving kindness and his faithfulness toward the house of Israel. All the ends of the earth have seen it.

So the whole world is called to a festival. People play the harp, the trumpets and the ram's horn before the King. Creation joins in: Let the sea roar. Let the rivers clap their hands. Let the mountains sing for joy together, for he comes to judge the earth with righteousness.

Show What You Know

  1. Who won the victory at the start of the psalm?

  2. Who has seen God's salvation?

  3. What promises did God remember?

  4. How does creation join the festival?

Word Bank Fill-In

Use the word bank to fill in each blank.

singriversGod
  1. himself won the victory.
  2. Let the clap their hands.
  3. Let the mountains for joy together, for he comes to judge the earth with righteousness.

Think About It

  1. What marvelous things has God done that you could sing about?

  2. Why do you think the psalm pictures rivers clapping their hands?

Memory Verse

“Yahweh has made known his salvation. He has openly shown his righteousness in the sight of the nations.”

Psalms 98:2 (WEB)

Copy It

Prayer

Dear God, thank You for your marvelous things. Help me . Amen.

Take It Home

For families: talk about these together.

  • What victory has God given you?
  • Who is the King?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 98 · Grade 5

He Comes to Judge the Earth

Name Date

Read and Think

Psalm 98 has only the title A Psalm and no named writer. It is closely related to Psalm 96: both begin, Sing to Yahweh a new song, and both end with God coming to judge the earth. Psalm 98 begins with the reason for the new song: he has done marvelous things! His right hand and his holy arm have worked salvation for him. The language of a right hand and holy arm recalls God's rescue of Israel at the Red Sea.

The salvation is public and covenantal. Yahweh has made known his salvation. He has openly shown his righteousness in the sight of the nations. He has remembered his loving kindness and his faithfulness toward the house of Israel. God's faithfulness to one nation becomes a display for all: All the ends of the earth have seen the salvation of our God.

The response grows in three circles. First Israel's temple orchestra plays harp, trumpets and ram's horn before the King, Yahweh. Then the whole earth makes a joyful noise. Finally creation itself joins: the sea roars, the rivers clap their hands, and the mountains sing for joy together. The reason is the King's coming: he will judge the world with righteousness, and the peoples with equity.

Show What You Know

  1. How is Psalm 98 related to Psalm 96?

  2. What event does the right hand and holy arm recall?

  3. How did God's faithfulness to Israel affect the world?

  4. What are the three circles of praise?

Crossword

34251

Across

  1. With ____ and sound of the ram’s horn.
  2. ____ praises to Yahweh with the harp.

Down

  1. With the ____ and the voice of melody.
  2. Sing to Yahweh a ____ song.
  3. Sing to Yahweh a new ____.

Think About It

  1. How can God's faithfulness to one person or group become a witness to others?

  2. What would it look like for your praise to be a joyful noise?

Memory Verse

“Let them sing before Yahweh, for he comes to judge the earth. He will judge the world with righteousness, and the peoples with equity.”

Psalms 98:9 (WEB)

Copy It

Prayer

Dear God, thank You for your marvelous things. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you get ready for the day God makes all things right?
  • What marvelous thing has God done for you?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.