The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 80

For teachers and parents. Prints separately from the student sheets.

Psalms 80 · For teachers and parents

Answer Key: Cause Your Face to Shine

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolThe Shepherd

sheepsunpersontree

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenShine on Us

SHINE → picture 2VINE → picture 4FLOCK → picture 1SHEPHERD → picture 3

Grade 1Turn Us Again

Hear us, Shepherd of Israel. → picture 2Cause your face to shine. → picture 4You brought a vine out of Egypt. → picture 5It filled the land. → picture 1Revive us. → picture 3

Order:

1. You who lead Joseph like a flock2. Cause your face to shine3. You brought a vine out of Egypt4. Turn us again, Yahweh God of Armies

Grade 2A Vine from Egypt

  1. What did Asaph call God? Our shepherd (circle)
  2. What happens when God smiles on us? We will be saved (circle)
  3. Where did God bring his people from? Egypt (circle)
  4. What were the people like? A vine (circle)
  5. What did Asaph pray? Help us again, God! (circle)
EHFLDRFFVBNASGDLLSUVCHNBOVVDCEESICWIEGYPTHKMNFKUHFUIKEPIUEFWMNNHHIRBDTDEWPYDFTWDN

Grade 3The Vine God Planted

  1. Who does Asaph call to hear them? The Shepherd of Israel
  2. How many times is the prayer to turn us again repeated? Three
  3. Where did God bring the vine from? Egypt
  4. What happened to the vine's walls? They were broken down.
  5. What will the people do if God revives them? Call on his name
1: You who lead Joseph like a flock2: Cause your face to shine3: You brought a vine out of Egypt4: Turn us again, Yahweh God of Armies
FBMLHVMFLLGODNELBTOSHINERAKCASVSHKIYKAVFACEKVFSHEPHERDTTWKPHMTCVINEGYPTPACDAIVUKE

Grade 4The Shepherd and the Vine

  1. How does the refrain grow stronger? From God to God of Armies to Yahweh God of Armies
  2. What does the bread of tears describe? The people's deep sorrow
  3. How far did the vine's branches reach? To the sea and the River
  4. What will the people do if God revives them? Not turn away and call on his name

Word bank: 1. Shepherd; 2. God; 3. face; 4. Egypt; 5. vine

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Turn Us Again

  1. Which tribes does verse 2 name? Ephraim, Benjamin and Manasseh
  2. What blessing does the refrain echo? The priestly blessing of Numbers 6
  3. What does the vine image show? Both God's past care and the people's present ruin
  4. How does the New Testament connect to the vine? Jesus calls himself the true vine (John 15:1).
4FACE1VIN2SHN3ELOCKGYPT

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.