The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 80

Every grade prints starting on a new page. No answers are included.

Psalms 80 · Preschool

The Shepherd

Name Date

Color the shepherd and the vine. God is our shepherd.

Can you find these in the picture? Circle each one!

Bible Verse

“Turn us again, God. Cause your face to shine, and we will be saved.”

Psalms 80:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God's people asked God to smile on them and save them. Let's make a big smile and say, Thank You, God!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 80 · Kindergarten

Shine on Us

Name Date

Trace the Words

Trace each word with your pencil.

SHINE
SAVE
VINE
SHEPHERD
Turn us again, God. Cause your face to shine, and we will be saved.

Psalms 80:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

SHINE
VINE
FLOCK
SHEPHERD

Mini Maze

Help find the way through the maze.

Draw It

Draw a big grapevine.

Prayer

Dear God, thank You for shining your face on us. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you ask God to smile on you?
  • How can you stay strong with God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 80 · Grade 1

Turn Us Again

Name Date

Trace the Words

Trace the words and the verse.

SHEPHERD
SHINE
VINE
REVIVE
Turn us again, God. Cause your face to shine, and we will be saved.

Psalms 80:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Hear us, Shepherd of Israel.
Cause your face to shine.
You brought a vine out of Egypt.
It filled the land.
Revive us.

The Vine

Write the number 1 to 4 in each circle to show the right order.

Cause your face to shine

You brought a vine out of Egypt

Turn us again, Yahweh God of Armies

You who lead Joseph like a flock

Draw a big grapevine.

Memory Verse

“Turn us again, God. Cause your face to shine, and we will be saved.”

Psalms 80:3 (WEB)

Prayer

Dear God, thank You for shining your face on us. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Asaph pray?
  • How has God planted you where you are?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 80 · Grade 2

A Vine from Egypt

Name Date

Read the Story

Asaph prayed to God. You are our shepherd. Please hear us. Smile on us, and we will be saved.

God brought his people out of Egypt. They were like a vine. God planted the vine. It grew big. Then it was hurt. Asaph asked God to help them again.

Memory Verse

“Turn us again, God. Cause your face to shine, and we will be saved.”

Psalms 80:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did Asaph call God?

    Our shepherdHelp us again, God!A vine

  2. What happens when God smiles on us?

    EgyptA vineWe will be saved

  3. Where did God bring his people from?

    A vineOur shepherdEgypt

  4. What were the people like?

    EgyptA vineWe will be saved

  5. What did Asaph pray?

    Help us again, God!Our shepherdA vine

Word Search

Find and circle each word. Words go across and down.

EHFLDRFFVBNASGDLLSUVCHNBOVVDCEESICWIEGYPTHKMNFKUHFUIKEPIUEFWMNNHHIRBDTDEWPYDFTWDN
  • SHEPHERD
  • FLOCK
  • SHINE
  • EGYPT
  • FACE
  • VINE

Prayer

Dear God, thank You for shining your face on us. Help me . Amen.

Take It Home

For families: talk about these together.

  • Israel asked God to shine on them. How does God lead you?
  • Who can you pray for at church?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 80 · Grade 3

The Vine God Planted

Name Date

Read the Story

The title of Psalm 80 calls it a Psalm by Asaph. Hear us, Shepherd of Israel, you who lead Joseph like a flock. Three times the psalm says, Turn us again, God. Cause your face to shine, and we will be saved.

The people were sad. You have fed them with the bread of tears. Asaph said Israel was like a vine. You brought a vine out of Egypt. You planted it. It took deep root, and filled the land.

But its walls were broken down, and wild animals fed on it. Asaph prayed, Look down from heaven, and see, and visit this vine. Revive us, and we will call on your name.

Memory Verse

“Turn us again, God. Cause your face to shine, and we will be saved.”

Psalms 80:3 (WEB)

Answer the Questions

  1. Who does Asaph call to hear them?

  2. How many times is the prayer to turn us again repeated?

  3. Where did God bring the vine from?

  4. What happened to the vine's walls?

  5. What will the people do if God revives them?

The Vine

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

FBMLHVMFLLGODNELBTOSHINERAKCASVSHKIYKAVFACEKVFSHEPHERDTTWKPHMTCVINEGYPTPACDAIVUKE
  • SHEPHERD
  • FLOCK
  • SHINE
  • EGYPT
  • FACE
  • VINE

Prayer

Dear God, thank You for shining your face on us. Help me . Amen.

Take It Home

For families: talk about these together.

  • The people asked God to hear and save. When do you ask God to hear you?
  • What is the bread of tears?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 80 · Grade 4

The Shepherd and the Vine

Name Date

Read and Think

The title of Psalm 80 calls it a Psalm by Asaph, set to the tune The Lilies of the Covenant. It prays to God as the Shepherd of Israel, you who sit above the cherubim, shine out. The refrain grows stronger each time, from God to God of Armies to Yahweh God of Armies: Turn us again. Cause your face to shine, and we will be saved.

The people feel God's anger against their prayers. You have fed them with the bread of tears. Then Asaph tells Israel's story as a vine. God brought it out of Egypt, cleared the ground and planted it. It took deep root, its shadow covered mountains, and its branches reached the sea and the River.

Now its walls are broken down. The boar ravages it, and it is burned with fire. Asaph begs God to visit this vine and to strengthen the man at his right hand. He promises, So we will not turn away from you. Revive us, and we will call on your name. In the New Testament, Jesus used the picture of a vine for himself (John 15:1).

Show What You Know

  1. How does the refrain grow stronger?

  2. What does the bread of tears describe?

  3. How far did the vine's branches reach?

  4. What will the people do if God revives them?

Word Bank Fill-In

Use the word bank to fill in each blank.

GodvinefaceShepherdEgypt
  1. It prays to God as the of Israel, you who sit above the cherubim, shine out.
  2. The refrain grows stronger each time, from to God of Armies to Yahweh God of Armies: Turn us again.
  3. Cause your to shine, and we will be saved.
  4. God brought it out of , cleared the ground and planted it.
  5. Asaph begs God to visit this and to strengthen the man at his right hand.

Think About It

  1. What does it mean to ask God to cause his face to shine on us?

  2. How can God revive a person or a church that feels broken?

Memory Verse

“Turn us again, God of Armies. Cause your face to shine, and we will be saved.”

Psalms 80:7 (WEB)

Copy It

Prayer

Dear God, thank You for shining your face on us. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is Israel pictured as a vine?
  • The people asked God to watch over the vine He planted. How do you need God to tend your life?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 80 · Grade 5

Turn Us Again

Name Date

Read and Think

The title of Psalm 80 says it is a Psalm by Asaph. It is a community lament, and verse 2 names the northern tribes Ephraim, Benjamin and Manasseh. The psalm is built on a refrain repeated in verses 3, 7 and 19, each time with a fuller name for God: Turn us again, God. Cause your face to shine, and we will be saved. The words echo the priestly blessing of Numbers 6.

The central picture is Israel as a vine. You brought a vine out of Egypt. You drove out the nations, and planted it. The vine flourished until its shade covered the mountains and its branches reached the sea. Then God allowed its walls to be broken down so that passersby plucked it and wild animals fed on it. The image shows both God's past care and the people's present ruin.

Asaph asks God to look down from heaven and visit this vine. He prays, Let your hand be on the man of your right hand, on the son of man whom you made strong for yourself. The people answer, So we will not turn away from you. Revive us, and we will call on your name. In the New Testament, Jesus calls himself the true vine (John 15:1), and many Christians read the man of God's right hand in light of him.

Show What You Know

  1. Which tribes does verse 2 name?

  2. What blessing does the refrain echo?

  3. What does the vine image show?

  4. How does the New Testament connect to the vine?

Crossword

4123

Across

  1. Cause your face to ____.
  2. Cause your ____ to shine.

Down

  1. You brought a ____ out of Egypt.
  2. You brought a vine out of ____.
  3. You who lead Joseph like a ____.

Think About It

  1. Why does the refrain use a fuller name for God each time?

  2. What would it mean for God to revive your faith?

Memory Verse

“Turn us again, Yahweh God of Armies. Cause your face to shine, and we will be saved.”

Psalms 80:19 (WEB)

Copy It

Prayer

Dear God, thank You for shining your face on us. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does John 15:1 connect to this psalm?
  • What would it look like for your faith to come alive again?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.