The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 72

For teachers and parents. Prints separately from the student sheets.

Psalms 72 · For teachers and parents

Answer Key: A King Who Helps the Poor

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Kind King

crownRainwheatpersonsun

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenA Good King

KING → picture 2RAIN → picture 4HELP → picture 1SUN → picture 3

Grade 1The King Helps

God, give the king your justice. → picture 2He will judge the poor fairly. → picture 4He will come down like rain. → picture 5Kings will bring gifts. → picture 1His name will last as long as the sun. → picture 3

Order:

1. God, give the king your justice2. He will judge the poor of the people3. He will come down like rain on the mown grass4. Abundance of grain shall be throughout the land

Grade 2A King Who Helps

  1. Who is the prayer for? A king (circle)
  2. Who should the king care for? Poor people (circle)
  3. What is a good king like? Rain on the grass (circle)
  4. What will kings bring him? Gifts (circle)
  5. What should fill the earth? God's glory (circle)
NTNAMERAKEASVSHKIYEGRASSAVKDVRAINFTTYWKKINGPHMJUSTICETCPACDPOORAIVGRAINUKEEWWNOSK

Grade 3Like Rain on the Grass

  1. Who is the psalm by, as the title says? Solomon
  2. What does the psalm ask God to give the king? God's justice
  3. What will the king be like? Rain on the mown grass
  4. Who will the king deliver? The needy and the poor
  5. What should fill the whole earth? God's glory
1: God, give the king your justice2: He will judge the poor of the people3: He will come down like rain on the mown grass4: Abundance of grain shall be throughout the land
TJAMUNATICRUVYNMNRKFASGLABHGIGITLJMLHENRNIGJEHNBGAECCUGRASSIEETPGFPRBNDMPOORGFCPY

Grade 4The Ideal King

  1. Whom is the king's power supposed to serve? The poor and needy
  2. What gentle picture describes the king? Rain on the mown grass, showers that water the earth
  3. What is the heart of the king's greatness? Mercy for the needy and the poor who has no helper
  4. What part of the Psalms does this psalm end? Book II

Word bank: 1. king; 2. justice; 3. rain; 4. poor

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Endless Reign, Endless Mercy

  1. What is the king's first task? Care for the poor and justice for the people, not conquest
  2. Which promise to Abraham does verse 17 echo? That all nations would be blessed
  3. What measures the king's glory? His compassion; the blood of the poor is precious in his sight.
  4. Why have Christians read this psalm as pointing beyond Solomon? Its hopes of an endless, worldwide reign are larger than any ordinary king and are, as Christians read it, fulfilled in the Messiah.
4JUSTICE3NEDY2RAN1POO

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.