The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 72

Every grade prints starting on a new page. No answers are included.

Psalms 72 · Preschool

A Kind King

Name Date

Color the crown and the rain. A good king helps people who are poor.

Can you find these in the picture? Circle each one!

Bible Verse

“For he will deliver the needy when he cries; the poor, who has no helper.”

Psalms 72:12 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: A good king helps people who need help. We can help others too. Let's think of one person we can help!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 72 · Kindergarten

A Good King

Name Date

Trace the Words

Trace each word with your pencil.

KING
HELP
RAIN
POOR
He will come down like rain on the mown grass, as showers that water the earth.

Psalms 72:6 (WEB)

Match the Pictures

Draw a line from each word to its picture.

KING
RAIN
HELP
SUN

Mini Maze

Help find the way through the maze.

Draw It

Draw rain falling on fresh grass.

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who wears a crown?
  • How can you help someone who is poor?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 72 · Grade 1

The King Helps

Name Date

Trace the Words

Trace the words and the verse.

KING
JUSTICE
RAIN
GLORY
He will come down like rain on the mown grass, as showers that water the earth.

Psalms 72:6 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God, give the king your justice.
He will judge the poor fairly.
He will come down like rain.
Kings will bring gifts.
His name will last as long as the sun.

A Righteous King

Write the number 1 to 4 in each circle to show the right order.

He will judge the poor of the people

God, give the king your justice

Abundance of grain shall be throughout the land

He will come down like rain on the mown grass

Draw rain falling on fresh grass.

Memory Verse

“He will come down like rain on the mown grass, as showers that water the earth.”

Psalms 72:6 (WEB)

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help someone who has less than you?
  • What could you offer to God this week?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 72 · Grade 2

A King Who Helps

Name Date

Read the Story

This is a prayer for a king. It asks God to help the king be fair and care for poor people.

A good king saves the needy. He is like rain on the grass. Kings will bring him gifts. Let the whole earth be full of God's glory!

Memory Verse

“For he will deliver the needy when he cries; the poor, who has no helper.”

Psalms 72:12 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who is the prayer for?

    Poor peopleA kingRain on the grass

  2. Who should the king care for?

    God's gloryPoor peopleA king

  3. What is a good king like?

    Poor peopleRain on the grassA king

  4. What will kings bring him?

    GiftsA kingPoor people

  5. What should fill the earth?

    God's gloryPoor peopleA king

Word Search

Find and circle each word. Words go across and down.

NTNAMERAKEASVSHKIYEGRASSAVKDVRAINFTTYWKKINGPHMJUSTICETCPACDPOORAIVGRAINUKEEWWNOSK
  • JUSTICE
  • NEEDY
  • GRASS
  • GRAIN
  • KING
  • POOR
  • RAIN
  • NAME

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who wrote this psalm, as the title says?
  • The psalm asks for a leader who brings peace. Who can you pray for every day?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 72 · Grade 3

Like Rain on the Grass

Name Date

Read the Story

The title says The title of Psalm 72 says it is by Solomon. It is a prayer for the king. God, give the king your justice. He will judge your people with righteousness, and your poor with justice.

The king will be like rain on the mown grass. In his days the righteous shall flourish. Kings of faraway lands will bring gifts. The king will deliver the needy when he cries, and the poor who has no helper.

His name will endure forever. Then comes praise: Blessed be his glorious name forever! Let the whole earth be filled with his glory! The last verse says the prayers by David, the son of Jesse, end here.

Memory Verse

“For he will deliver the needy when he cries; the poor, who has no helper.”

Psalms 72:12 (WEB)

Answer the Questions

  1. Who is the psalm by, as the title says?

  2. What does the psalm ask God to give the king?

  3. What will the king be like?

  4. Who will the king deliver?

  5. What should fill the whole earth?

A Righteous King

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

TJAMUNATICRUVYNMNRKFASGLABHGIGITLJMLHENRNIGJEHNBGAECCUGRASSIEETPGFPRBNDMPOORGFCPY
  • JUSTICE
  • NEEDY
  • GRASS
  • GRAIN
  • KING
  • POOR
  • RAIN
  • NAME

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • The mountains would bring peace to the people. How can you bring peace to your home?
  • How can you care for those who have little?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 72 · Grade 4

The Ideal King

Name Date

Read and Think

Psalm 72 is by Solomon, as its title says. It is a prayer for the king and the royal son. God, give the king your justice; your righteousness to the royal son. The king's power is supposed to serve the poor: he will judge the poor of the people and save the children of the needy.

The psalm uses gentle pictures for this king. He will come down like rain on the mown grass, as showers that water the earth. In his days the righteous flourish, and peace abounds until the moon is no more. Kings from Tarshish, Sheba and Seba bring gifts.

The heart of his greatness is mercy. He will deliver the needy when he cries; the poor, who has no helper. Their blood will be precious in his sight. The psalm ends Book II of the Psalms with praise to Yahweh, who alone does marvelous deeds, and the note that this ends the prayers by David, the son of Jesse.

Show What You Know

  1. Whom is the king's power supposed to serve?

  2. What gentle picture describes the king?

  3. What is the heart of the king's greatness?

  4. What part of the Psalms does this psalm end?

Word Bank Fill-In

Use the word bank to fill in each blank.

kingpoorjusticerain
  1. It is a prayer for the and the royal son.
  2. God, give the king your ; your righteousness to the royal son.
  3. He will come down like on the mown grass, as showers that water the earth.
  4. He will deliver the needy when he cries; the , who has no helper.

Think About It

  1. How can people with power use it to help the weak?

  2. How can you be like rain on dry grass for someone this week?

Memory Verse

“For he will deliver the needy when he cries; the poor, who has no helper.”

Psalms 72:12 (WEB)

Copy It

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does it mean that the king's name endures forever?
  • How does verse 17 echo the promise to Abraham?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 72 · Grade 5

Endless Reign, Endless Mercy

Name Date

Read and Think

The title of Psalm 72 says it is by Solomon. It prays for the king and the royal son, asking God to give him justice and righteousness. The king's first task is not conquest but care: He will judge your people with righteousness, and your poor with justice. He will save the children of the needy and break the oppressor in pieces.

The psalm's hopes grow larger than any ordinary king. His dominion reaches from sea to sea and to the ends of the earth. All nations shall serve him. His name endures forever, as long as the sun. Men shall be blessed by him; all nations will call him blessed. These words echo God's promise to Abraham that all nations would be blessed.

Yet the king's glory is measured by compassion. He will have pity on the poor and needy, and their blood will be precious in his sight. Christians have long read this psalm as pointing beyond Solomon to the Messiah, whose rule fulfills these hopes. The doxology closes Book II: Let the whole earth be filled with his glory! Amen and amen. Verse 20 adds, This ends the prayers by David, the son of Jesse.

Show What You Know

  1. What is the king's first task?

  2. Which promise to Abraham does verse 17 echo?

  3. What measures the king's glory?

  4. Why have Christians read this psalm as pointing beyond Solomon?

Crossword

4321

Across

  1. He will judge the ____ of the people.
  2. Give the king your ____.

Down

  1. He will come down like ____ on the mown grass.
  2. He will save the children of the ____.

Think About It

  1. What would a leader look like who truly protected the poor and needy?

  2. How does this psalm help you pray for leaders today?

Memory Verse

“His name endures forever. His name continues as long as the sun. Men shall be blessed by him. All nations will call him blessed.”

Psalms 72:17 (WEB)

Copy It

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • The king's rule would last as long as the sun. How does a forever King shape your hope?
  • What would you ask God to do for your country's leaders?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.