The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 72

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 72 · Grade 2

A King Who Helps

Name Date

Read the Story

This is a prayer for a king. It asks God to help the king be fair and care for poor people.

A good king saves the needy. He is like rain on the grass. Kings will bring him gifts. Let the whole earth be full of God's glory!

Memory Verse

“For he will deliver the needy when he cries; the poor, who has no helper.”

Psalms 72:12 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who is the prayer for?

    Poor peopleA kingRain on the grass

  2. Who should the king care for?

    God's gloryPoor peopleA king

  3. What is a good king like?

    Poor peopleRain on the grassA king

  4. What will kings bring him?

    GiftsA kingPoor people

  5. What should fill the earth?

    God's gloryPoor peopleA king

Word Search

Find and circle each word. Words go across and down.

NTNAMERAKEASVSHKIYEGRASSAVKDVRAINFTTYWKKINGPHMJUSTICETCPACDPOORAIVGRAINUKEEWWNOSK
  • JUSTICE
  • NEEDY
  • GRASS
  • GRAIN
  • KING
  • POOR
  • RAIN
  • NAME

Prayer

Dear God, thank You for caring for the poor. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who wrote this psalm, as the title says?
  • The psalm asks for a leader who brings peace. Who can you pray for every day?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.