The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 6

For teachers and parents. Prints separately from the student sheets.

Psalms 6 · For teachers and parents

Answer Key: God Hears My Prayer

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Hears Me

personheartmoon and stars

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Hears

PRAY → picture 4LOVE → picture 3NIGHT → picture 2DAVID → picture 1

Grade 1God Heard My Prayer

David was weak and sad. → picture 3He asked God for mercy. → picture 5He cried every night. → picture 2God heard his weeping. → picture 4God accepts his prayer. → picture 1

Order:

1. For my bones are troubled2. And save me for your loving kindness3. I drench my couch with my tears4. Yahweh has heard my supplication

Grade 2God Heard Me

  1. What did David ask God for? Mercy and to heal him
  2. When did David cry? Every night (circle)
  3. What was wet with tears? His bed (circle)
  4. Who heard David's prayer? Yahweh (circle)
  5. What does God do with David's prayer? He accepts it. (circle)
ALHMERCYGSPUEGBANVSAVEABNASPEAGRLMSORWEEPINGUATEARSVVLYHEARDKCOEIBPUBMDRRIUFKHECL

Grade 3How Long?

  1. What instrument does the title name? The eight-stringed lyre
  2. What question does David ask? How long?
  3. For what sake does David ask God to save him? For his loving kindness' sake
  4. What does David do to his bed every night? He floods it with tears.
  5. What has Yahweh heard? The voice of his weeping
1: For my bones are troubled2: And save me for your loving kindness3: I drench my couch with my tears4: Yahweh has heard my supplication
AKVMERCYOEJGBNILPEWPRAYERLETEARSSKAPCHDRHEARDWEEPINGVPKAIFALULERLSOULABGYLLERFIIG

Grade 4Tears and Trust

  1. What does David first ask Yahweh not to do? Rebuke him in anger
  2. For whose sake does David ask God to deliver him? For the sake of God's loving kindness
  3. How does David describe his nights? He drenches his couch with his tears.
  4. What changes at the end of the psalm? David says Yahweh has heard his weeping and accepts his prayer.

Word bank: 1. mercy; 2. soul; 3. tears; 4. weeping; 5. prayer

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Yahweh Has Heard

  1. What have believers long called Psalm 6 and similar psalms? Penitential psalms, prayers of sorrow and repentance
  2. What does loving kindness mean in this psalm? God's faithful covenant love
  3. Where does the psalm turn? In verse 8
  4. In the New Testament, where does Jesus use words like verse 8? Matthew 7:23
2MERCY1TAR4SAVE3WEPING

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.