The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 6

Every grade prints starting on a new page. No answers are included.

Psalms 6 · Preschool

God Hears Me

Name Date

Color the praying hands, the heart, and the moon. God hears us when we are sad.

Can you find these in the picture? Circle each one!

Bible Verse

“Yahweh has heard my supplication. Yahweh accepts my prayer.”

Psalms 6:9 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Sometimes we feel sad. God hears our prayers. Let's give a hug to someone and say, God hears you.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 6 · Kindergarten

God Hears

Name Date

Trace the Words

Trace each word with your pencil.

HEAR
PRAY
HEAL
HELP
Yahweh has heard my supplication. Yahweh accepts my prayer.

Psalms 6:9 (WEB)

Match the Pictures

Draw a line from each word to its picture.

PRAY
LOVE
NIGHT
DAVID

Mini Maze

Help find the way through the maze.

Draw It

Draw someone being comforted.

Prayer

Dear God, thank You for hearing my cries. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who hears us when we are sad?
  • How did David feel?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 6 · Grade 1

God Heard My Prayer

Name Date

Trace the Words

Trace the words and the verse.

MERCY
HEAL
TEARS
PRAYER
Yahweh has heard my supplication. Yahweh accepts my prayer.

Psalms 6:9 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

David was weak and sad.
He asked God for mercy.
He cried every night.
God heard his weeping.
God accepts his prayer.

God Hears My Tears

Write the number 1 to 4 in each circle to show the right order.

And save me for your loving kindness

For my bones are troubled

Yahweh has heard my supplication

I drench my couch with my tears

Draw someone being comforted.

Memory Verse

“Yahweh has heard my supplication. Yahweh accepts my prayer.”

Psalms 6:9 (WEB)

Prayer

Dear God, thank You for hearing my cries. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who needs your prayers today?
  • Who can you hug when they are sad?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 6 · Grade 2

God Heard Me

Name Date

Read the Story

The title says this is a Psalm by David. David was sad and weak. He asked God, Have mercy on me. He asked God to heal him. He asked, How long?

David was tired. He cried every night. His bed was wet with tears. But then David said something new. Yahweh has heard my supplication. That means God heard his prayer. Yahweh accepts his prayer.

Memory Verse

“Yahweh has heard my supplication. Yahweh accepts my prayer.”

Psalms 6:9 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did David ask God for?

  2. When did David cry?

    Mercy and to heal himHis bedEvery night

  3. What was wet with tears?

    His bedHe accepts itMercy and to heal him

  4. Who heard David's prayer?

    YahwehMercy and to heal himHe accepts it

  5. What does God do with David's prayer?

    He accepts itYahwehMercy and to heal him

Word Search

Find and circle each word. Words go across and down.

ALHMERCYGSPUEGBANVSAVEABNASPEAGRLMSORWEEPINGUATEARSVVLYHEARDKCOEIBPUBMDRRIUFKHECL
  • WEEPING
  • PRAYER
  • MERCY
  • TEARS
  • HEARD
  • HEAL
  • SOUL
  • SAVE

Prayer

Dear God, thank You for hearing my cries. Help me . Amen.

Take It Home

For families: talk about these together.

  • David felt weak and tired. What can you do when you feel weak?
  • What did God hear?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 6 · Grade 3

How Long?

Name Date

Read the Story

The title says this psalm is for the Chief Musician, on stringed instruments, upon the eight-stringed lyre. It says it is a Psalm by David. David asks Yahweh not to rebuke him in anger. He says, Have mercy on me. He is faint, and his bones are troubled. He asks, How long?

David asks Yahweh to return and save him for his loving kindness' sake. David is weary with his groaning. Every night he floods his bed with tears. His eye wastes away because of grief.

Then David's words change. He tells the workers of iniquity to depart from him. Yahweh has heard the voice of his weeping. Yahweh has heard his supplication and accepts his prayer. David says his enemies shall turn back.

Memory Verse

“Yahweh has heard my supplication. Yahweh accepts my prayer.”

Psalms 6:9 (WEB)

Answer the Questions

  1. What instrument does the title name?

  2. What question does David ask?

  3. For what sake does David ask God to save him?

  4. What does David do to his bed every night?

  5. What has Yahweh heard?

God Hears My Tears

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

AKVMERCYOEJGBNILPEWPRAYERLETEARSSKAPCHDRHEARDWEEPINGVPKAIFALULERLSOULABGYLLERFIIG
  • WEEPING
  • PRAYER
  • MERCY
  • TEARS
  • HEARD
  • HEAL
  • SOUL
  • SAVE

Prayer

Dear God, thank You for hearing my cries. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who can you comfort when they feel down?
  • How did David's words change?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 6 · Grade 4

Tears and Trust

Name Date

Read and Think

Psalm 6's title says it is for the Chief Musician, on stringed instruments, upon the eight-stringed lyre, and that it is a Psalm by David. David begins by asking Yahweh not to rebuke him in anger. He pleads, Have mercy on me, Yahweh, for I am faint. His bones are troubled and his soul is in great anguish, and he cries out, But you, Yahweh, how long?

David asks Yahweh to return and deliver his soul for his loving kindness' sake. He describes his sorrow honestly. He is weary with his groaning, and every night he drenches his couch with his tears. His eye wastes away because of grief and because of his adversaries.

Suddenly the psalm turns. David tells all the workers of iniquity to depart from him, for Yahweh has heard the voice of his weeping. Three times he says that God has heard or accepts his prayer. He is sure that his enemies shall turn back.

Show What You Know

  1. What does David first ask Yahweh not to do?

  2. For whose sake does David ask God to deliver him?

  3. How does David describe his nights?

  4. What changes at the end of the psalm?

Word Bank Fill-In

Use the word bank to fill in each blank.

mercytearssoulweepingprayer
  1. He pleads, Have on me, Yahweh, for I am faint.
  2. His bones are troubled and his is in great anguish, and he cries out, But you, Yahweh, how long?
  3. He is weary with his groaning, and every night he drenches his couch with his .
  4. David tells all the workers of iniquity to depart from him, for Yahweh has heard the voice of his .
  5. Three times he says that God has heard or accepts his .

Think About It

  1. David told God exactly how sad he felt. How can you be honest with God when you are sad?

  2. David was sure God heard him, even before things changed. Who could you encourage with this psalm?

Memory Verse

“Yahweh has heard my supplication. Yahweh accepts my prayer.”

Psalms 6:9 (WEB)

Copy It

Prayer

Dear God, thank You for hearing my cries. Help me . Amen.

Take It Home

For families: talk about these together.

  • When have you felt God's mercy when you did not deserve it?
  • What heavy feeling could you tell God about honestly?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 6 · Grade 5

Yahweh Has Heard

Name Date

Read and Think

Psalm 6's title reads: For the Chief Musician; on stringed instruments, upon the eight-stringed lyre. A Psalm by David. Believers have long counted it among the penitential psalms, prayers of sorrow and repentance. David asks God not to rebuke or discipline him in wrath. He does not argue that he deserves nothing; he asks for mercy.

David's whole person is in anguish. His bones are troubled, his soul is in great anguish, and he cries, How long? He appeals to God's loving kindness, God's faithful covenant love. He reasons that in death there is no memory of God and that in Sheol no one gives God thanks. He is weary, and every night he floods his bed with tears.

The turn comes suddenly in verse 8. David tells the workers of iniquity to depart, because Yahweh has heard the voice of his weeping. He repeats the truth: Yahweh has heard my supplication. Yahweh accepts my prayer. The psalm shows that honest lament can lead to confident faith. In the New Testament, Jesus uses words like verse 8 when he tells workers of iniquity to depart from him (Matthew 7:23).

Show What You Know

  1. What have believers long called Psalm 6 and similar psalms?

  2. What does loving kindness mean in this psalm?

  3. Where does the psalm turn?

  4. In the New Testament, where does Jesus use words like verse 8?

Crossword

2143

Across

  1. Have ____ on me.
  2. And ____ me for your loving kindness.

Down

  1. I drench my couch with my ____.
  2. For Yahweh has heard the voice of my ____.

Think About It

  1. Psalm 6 moves from tears to trust. What can you learn from David about praying when life is hard?

  2. David appealed to God's loving kindness, not his own goodness. How does that change the way you ask God for help?

Memory Verse

“Yahweh has heard my supplication. Yahweh accepts my prayer.”

Psalms 6:9 (WEB)

Copy It

Prayer

Dear God, thank You for hearing my cries. Help me . Amen.

Take It Home

For families: talk about these together.

  • David told evildoers to leave because God heard him. How does confidence that God hears you change how you handle people who hurt you?
  • How can you bring your sad feelings to God?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.