The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 28

For teachers and parents. Prints separately from the student sheets.

Psalms 28 · For teachers and parents

Answer Key: My Strength and My Shield

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Helps Me

rockheartstaff

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Is My Strength

STRONG → picture 2TRUST → picture 4SONG → picture 1SHEEP → picture 3

Grade 1My Heart Trusts God

David called to God. → picture 2God heard his prayer. → picture 4God is my strength. → picture 5David's heart trusted in God. → picture 1Be our shepherd forever. → picture 3

Order:

1. To you, Yahweh, I call2. Blessed be Yahweh, because he has heard the voice of my petitions3. Yahweh is my strength and my shield4. And bear them up forever

Grade 2God Heard Me

  1. What did David call God? My rock (circle)
  2. What did David do with his hands? Lifted them up and prayed
  3. Why did David bless Yahweh? Because God heard his prayers
  4. What is Yahweh to David? His strength and his shield
  5. What did David ask God to be for his people? Their shepherd (circle)
SLKSHEARTOTVSHABHRNWRHHITULGMREVAEGGSTBPNONLEWKMHKGIDDIVWERFTCSUPIRDDFHEWAFDROCKE

Grade 3I Am Helped

  1. Toward what place does David lift his hands? God's Most Holy Place
  2. What is in the hearts of the wicked? Mischief
  3. What has Yahweh heard? The voice of David's petitions
  4. What happened when David's heart trusted? He was helped.
  5. How will David thank God? With his song
1: To you, Yahweh, I call2: Blessed be Yahweh, because he has heard the voice of my petitions3: Yahweh is my strength and my shield4: And bear them up forever
BFMPDTJKSVSTRENGTHORNKAGWCIIDONHINHECGTCFECVLEYVMKAAGDYSHEPHERDLTESONGCTUMHANDSJL

Grade 4From Plea to Praise

  1. How do the wicked in this psalm speak? They speak peace with their neighbors, but mischief is in their hearts.
  2. Where does the mood of the psalm change? Verse 6
  3. What happened because David trusted? He was helped, and his heart greatly rejoices.
  4. How does David's prayer widen at the end? From himself to all God's people

Word bank: 1. rock; 2. voice; 3. shepherd

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Shepherd Who Carries His People

  1. Why would God's silence feel like death to David? He depended on God to answer him.
  2. What is the Most Holy Place? The inner room of God's sanctuary
  3. What does David do with the need for justice? He leaves it in God's hands rather than taking revenge.
  4. What image ends the psalm? A shepherd who bears up his people forever
5STRENGTH2VOIC1HAND4HEAR3SIELD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.