The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 28

Every grade prints starting on a new page. No answers are included.

Psalms 28 · Preschool

God Helps Me

Name Date

Color the tower and the sheep. God is strong and helps us.

Can you find these in the picture? Circle each one!

Bible Verse

“Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. Therefore my heart greatly rejoices. With my song I will thank him.”

Psalms 28:7 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God is our strength. He helps us when we trust Him. Let's make strong arms and say, God is my strength!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 28 · Kindergarten

God Is My Strength

Name Date

Trace the Words

Trace each word with your pencil.

STRONG
SHIELD
TRUST
SONG
Save your people, and bless your inheritance. Be their shepherd also, and bear them up forever.

Psalms 28:9 (WEB)

Match the Pictures

Draw a line from each word to its picture.

STRONG
TRUST
SONG
SHEEP

Mini Maze

Help find the way through the maze.

Draw It

Draw God carrying His people.

Prayer

Dear God, thank You for being my strength. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who is your strength?
  • Who helps you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 28 · Grade 1

My Heart Trusts God

Name Date

Trace the Words

Trace the words and the verse.

CALL
HEARD
SHIELD
SHEPHERD
Save your people, and bless your inheritance. Be their shepherd also, and bear them up forever.

Psalms 28:9 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

David called to God.
God heard his prayer.
God is my strength.
David's heart trusted in God.
Be our shepherd forever.

Hear My Cry

Write the number 1 to 4 in each circle to show the right order.

And bear them up forever

Yahweh is my strength and my shield

To you, Yahweh, I call

Blessed be Yahweh, because he has heard the voice of my petitions

Draw God carrying His people.

Memory Verse

“Save your people, and bless your inheritance. Be their shepherd also, and bear them up forever.”

Psalms 28:9 (WEB)

Prayer

Dear God, thank You for being my strength. Help me . Amen.

Take It Home

For families: talk about these together.

  • When do you talk to God?
  • How can you thank God?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 28 · Grade 2

God Heard Me

Name Date

Read the Story

The title says this psalm is by David. David called to Yahweh. He said, My rock, don't be deaf to me. He lifted up his hands and prayed.

Then David was glad. He said, Blessed be Yahweh, because he has heard the voice of my petitions. Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. David asked God to be the shepherd of his people forever.

Memory Verse

“Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. Therefore my heart greatly rejoices. With my song I will thank him.”

Psalms 28:7 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did David call God?

    My rockTheir shepherdLifted them up and prayed

  2. What did David do with his hands?

  3. Why did David bless Yahweh?

  4. What is Yahweh to David?

  5. What did David ask God to be for his people?

    Their shepherdLifted them up and prayedMy rock

Word Search

Find and circle each word. Words go across and down.

SLKSHEARTOTVSHABHRNWRHHITULGMREVAEGGSTBPNONLEWKMHKGIDDIVWERFTCSUPIRDDFHEWAFDROCKE
  • STRENGTH
  • SHEPHERD
  • SHIELD
  • VOICE
  • HANDS
  • HEART
  • ROCK
  • SONG

Prayer

Dear God, thank You for being my strength. Help me . Amen.

Take It Home

For families: talk about these together.

  • The singer's heart leaped for joy. What makes your heart happy?
  • Some people said kind words but had mean hearts. How can your words and heart match?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 28 · Grade 3

I Am Helped

Name Date

Read the Story

The title says this psalm is By David. To you, Yahweh, I call. My rock, don't be deaf to me. David lifts up his hands toward God's Most Holy Place. He asks God not to draw him away with the wicked, who speak peace with their neighbors, but mischief is in their hearts.

Then David's prayer turns to praise. Blessed be Yahweh, because he has heard the voice of my petitions. Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. With my song I will thank him. David prays, Save your people. Be their shepherd also.

Memory Verse

“Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. Therefore my heart greatly rejoices. With my song I will thank him.”

Psalms 28:7 (WEB)

Answer the Questions

  1. Toward what place does David lift his hands?

  2. What is in the hearts of the wicked?

  3. What has Yahweh heard?

  4. What happened when David's heart trusted?

  5. How will David thank God?

Hear My Cry

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

BFMPDTJKSVSTRENGTHORNKAGWCIIDONHINHECGTCFECVLEYVMKAAGDYSHEPHERDLTESONGCTUMHANDSJL
  • STRENGTH
  • SHEPHERD
  • SHIELD
  • VOICE
  • HANDS
  • HEART
  • ROCK
  • SONG

Prayer

Dear God, thank You for being my strength. Help me . Amen.

Take It Home

For families: talk about these together.

  • David asked God not to be quiet. How can you keep talking to God every day?
  • God is like a shepherd who carries His people. How does God carry you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 28 · Grade 4

From Plea to Praise

Name Date

Read and Think

Psalm 28's title says it is By David. It begins with urgent prayer. David calls Yahweh his rock and begs him not to be silent. He lifts his hands toward God's Most Holy Place. He asks not to be dragged away with the wicked, who speak peace with their neighbors, but mischief is in their hearts. Their words sound friendly, but their hearts are not. He asks God to give them what their deeds deserve, because they don't respect the works of Yahweh.

In verse 6 the mood changes completely. Blessed be Yahweh, because he has heard the voice of my petitions. David's heart trusted, and he was helped, so his heart greatly rejoices. Then his prayer widens from himself to all God's people: Save your people, and bless your inheritance. Be their shepherd also, and bear them up forever.

Show What You Know

  1. How do the wicked in this psalm speak?

  2. Where does the mood of the psalm change?

  3. What happened because David trusted?

  4. How does David's prayer widen at the end?

Word Bank Fill-In

Use the word bank to fill in each blank.

voiceshepherdrock
  1. David calls Yahweh his and begs him not to be silent.
  2. Blessed be Yahweh, because he has heard the of my petitions.
  3. Be their also, and bear them up forever.

Think About It

  1. David's prayer turned into praise. Can you remember a time when God answered your prayer?

  2. Some people speak kindly but have mischief in their hearts. How can you make your words and heart match?

Memory Verse

“Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. Therefore my heart greatly rejoices. With my song I will thank him.”

Psalms 28:7 (WEB)

Copy It

Prayer

Dear God, thank You for being my strength. Help me . Amen.

Take It Home

For families: talk about these together.

  • David asked God to repay evildoers by their deeds. How can you leave payback to God?
  • Can you recall a time God heard you and helped you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 28 · Grade 5

The Shepherd Who Carries His People

Name Date

Read and Think

Psalm 28's title says it is By David. It opens with a cry: To you, Yahweh, I call. My rock, don't be deaf to me, lest, if you are silent to me, I would become like those who go down into the pit. For David, God's silence would feel like death. He lifts his hands toward the Most Holy Place, the inner room of God's sanctuary, as a sign of dependence.

David asks not to be drawn away with the workers of iniquity who speak peace with their neighbors, but mischief is in their hearts. He asks God to give them what their deeds deserve, because they don't respect the works of Yahweh. He leaves justice in God's hands rather than taking revenge himself.

Then comes a sudden turn to thanksgiving: Blessed be Yahweh, because he has heard the voice of my petitions. Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. Therefore my heart greatly rejoices. David then remembers that God is a stronghold of salvation to his anointed, and he ends by praying for the whole nation: Save your people, and bless your inheritance. Be their shepherd also, and bear them up forever. The image of a shepherd carrying his sheep fits the God who cares for his people.

Show What You Know

  1. Why would God's silence feel like death to David?

  2. What is the Most Holy Place?

  3. What does David do with the need for justice?

  4. What image ends the psalm?

Crossword

52143

Across

  1. Yahweh is my strength and my ____.
  2. Yahweh is my ____ and my shield.

Down

  1. Give them according to the operation of their ____.
  2. Because he has heard the ____ of my petitions.
  3. My ____ has trusted in him.

Think About It

  1. David left justice to God instead of getting even. How can that help you when someone treats you unfairly?

  2. David prayed for all God's people, not just himself. Who can you pray for besides yourself this week?

Memory Verse

“Yahweh is my strength and my shield. My heart has trusted in him, and I am helped. Therefore my heart greatly rejoices. With my song I will thank him.”

Psalms 28:7 (WEB)

Copy It

Prayer

Dear God, thank You for being my strength. Help me . Amen.

Take It Home

For families: talk about these together.

  • The wicked do not regard the works of the Lord. How can paying attention to what God does protect you from drifting?
  • How can you thank God for a time He heard you?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.