The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 27

For teachers and parents. Prints separately from the student sheets.

Psalms 27 · For teachers and parents

Answer Key: Yahweh Is My Light

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Is My Light

lighttentrockheartEye

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Is My Light

LIGHT → picture 4ROCK → picture 3HOUSE → picture 1HEART → picture 2

Grade 1Whom Shall I Fear?

Yahweh is my light. → picture 5Whom shall I fear? → picture 1I want to live in God's house. → picture 4He will lift me up on a rock. → picture 2Wait for Yahweh. → picture 3

Order:

1. Yahweh is my light and my salvation2. One thing I have asked of Yahweh3. He will keep me secretly in his pavilion4. And let your heart take courage

Grade 2The Lord Is My Light

  1. What is Yahweh to David? His light and his salvation
  2. What happened to the bad people? They stumbled and fell. (circle)
  3. What one thing did David want most? To live in Yahweh's house
  4. What will God do in the day of trouble? Keep David safe (circle)
  5. What should we wait for? Yahweh (circle)
APLIFSSKUFSPIFETNCRBTYGILHOATERYHGOIIREAELTUFDHOMUNGSAWTNCPTGECENOIKLYTEPKTAHPEBH

Grade 3One Thing I Ask

  1. What is Yahweh the strength of? David's life
  2. What will David's heart not do even if an army camps against him? Fear
  3. What one thing does David ask? To dwell in Yahweh's house all the days of his life
  4. What did David's heart answer when God said Seek my face? I will seek your face, Yahweh.
  5. What does the last verse tell us to do? Wait for Yahweh, be strong, and take courage.
1: Yahweh is my light and my salvation2: One thing I have asked of Yahweh3: He will keep me secretly in his pavilion4: And let your heart take courage
RSWHOUSEUORTBSRYNYCATRLIGHTKFEEEHMNSFRMVFNMFSMAPHAGGMKAILNCFATRWDEUEBVFHJGBEAUTYF

Grade 4Courage in the Dark

  1. What do light and salvation mean in verse 1? Light drives away darkness, and salvation means rescue.
  2. Where does David's courage come from? From God
  3. What is David's deepest desire? To dwell in Yahweh's house and see his beauty
  4. What will Yahweh do if David's father and mother forsake him? Take him up

Word bank: 1. light; 2. God; 3. face

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Seek His Face and Wait

  1. What two moods does Psalm 27 hold? Fearless confidence and earnest prayer
  2. What is David's single desire? To dwell in Yahweh's house, see his beauty, and inquire in his temple
  3. What does David say his heart answered God's invitation? I will seek your face, Yahweh.
  4. What is David confident he will see? The goodness of Yahweh in the land of the living
4BEAUTY3TMPLE5STRNGTH1LIGH2AFRAD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.