The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 27

Every grade prints starting on a new page. No answers are included.

Psalms 27 · Preschool

God Is My Light

Name Date

Color the light and the rock. God helps us be strong and brave.

Can you find these in the picture? Circle each one!

Bible Verse

“Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.”

Psalms 27:14 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: David said to wait for God and be strong. God helps us when we are scared! Let's stand tall and say, God makes me brave!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 27 · Kindergarten

God Is My Light

Name Date

Trace the Words

Trace each word with your pencil.

LIGHT
SAFE
SEEK
WAIT
Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.

Psalms 27:14 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LIGHT
ROCK
HOUSE
HEART

Mini Maze

Help find the way through the maze.

Draw It

Draw a light shining in the dark.

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can God chase your fears away?
  • Do you need to be afraid?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 27 · Grade 1

Whom Shall I Fear?

Name Date

Trace the Words

Trace the words and the verse.

LIGHT
FEAR
SEEK
WAIT
Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.

Psalms 27:14 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Yahweh is my light.
Whom shall I fear?
I want to live in God's house.
He will lift me up on a rock.
Wait for Yahweh.

My Light and Salvation

Write the number 1 to 4 in each circle to show the right order.

He will keep me secretly in his pavilion

And let your heart take courage

One thing I have asked of Yahweh

Yahweh is my light and my salvation

Draw a light shining in the dark.

Memory Verse

“Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.”

Psalms 27:14 (WEB)

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do you want most from God?
  • How can you seek God?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 27 · Grade 2

The Lord Is My Light

Name Date

Read the Story

The title says this psalm is by David. David said, Yahweh is my light and my salvation. Whom shall I fear? Even when bad people came at him, they stumbled and fell.

David wanted one thing most of all. He wanted to live in Yahweh's house all the days of his life. God would keep him safe in the day of trouble. David said, Wait for Yahweh. Be strong, and let your heart take courage.

Memory Verse

“Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.”

Psalms 27:14 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What is Yahweh to David?

  2. What happened to the bad people?

    They stumbled and fellYahwehKeep David safe

  3. What one thing did David want most?

  4. What will God do in the day of trouble?

    YahwehTo live in Yahweh's houseKeep David safe

  5. What should we wait for?

    Keep David safeThey stumbled and fellYahweh

Word Search

Find and circle each word. Words go across and down.

APLIFSSKUFSPIFETNCRBTYGILHOATERYHGOIIREAELTUFDHOMUNGSAWTNCPTGECENOIKLYTEPKTAHPEBH
  • STRENGTH
  • AFRAID
  • BEAUTY
  • TEMPLE
  • LIGHT
  • HOUSE
  • ROCK
  • FACE

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • The singer was not afraid because God was near. What can you do when you feel afraid?
  • The singer asked to be taught the right way. What can God teach you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 27 · Grade 3

One Thing I Ask

Name Date

Read the Story

The title says this psalm is By David. Yahweh is my light and my salvation. Whom shall I fear? Yahweh is the strength of my life. Of whom shall I be afraid? Even if an army should camp against him, his heart shall not fear.

One thing I have asked of Yahweh: that I may dwell in Yahweh's house all the days of my life, to see Yahweh's beauty. In the day of trouble, God will hide him and lift him up on a rock. When God said, Seek my face, David's heart answered, I will seek your face, Yahweh. Wait for Yahweh. Be strong, and let your heart take courage.

Memory Verse

“Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.”

Psalms 27:14 (WEB)

Answer the Questions

  1. What is Yahweh the strength of?

  2. What will David's heart not do even if an army camps against him?

  3. What one thing does David ask?

  4. What did David's heart answer when God said Seek my face?

  5. What does the last verse tell us to do?

My Light and Salvation

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

RSWHOUSEUORTBSRYNYCATRLIGHTKFEEEHMNSFRMVFNMFSMAPHAGGMKAILNCFATRWDEUEBVFHJGBEAUTYF
  • STRENGTH
  • AFRAID
  • BEAUTY
  • TEMPLE
  • LIGHT
  • HOUSE
  • ROCK
  • FACE

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be strong as you trust God?
  • The singer longed for a smooth path. Where do you want God to lead you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 27 · Grade 4

Courage in the Dark

Name Date

Read and Think

Psalm 27's title says it is By David. It opens with bold confidence: Yahweh is my light and my salvation. Whom shall I fear? Light drives away darkness, and salvation means rescue. When enemies came at David, they stumbled and fell. Even if an army should camp against him, his heart would not fear. David's courage comes from God, not from himself.

David's deepest desire is not victory but closeness to God. One thing I have asked of Yahweh: to dwell in Yahweh's house all the days of my life, to see Yahweh's beauty. God will hide him in the day of trouble. The second half becomes a prayer. When God said, Seek my face, David answered, I will seek your face, Yahweh. Even if his father and mother forsook him, Yahweh would take him up. The psalm ends, Wait for Yahweh. Be strong, and let your heart take courage.

Show What You Know

  1. What do light and salvation mean in verse 1?

  2. Where does David's courage come from?

  3. What is David's deepest desire?

  4. What will Yahweh do if David's father and mother forsake him?

Word Bank Fill-In

Use the word bank to fill in each blank.

lightfaceGod
  1. It opens with bold confidence: Yahweh is my and my salvation.
  2. will hide him in the day of trouble.
  3. When God said, Seek my , David answered, I will seek your face, Yahweh.

Think About It

  1. What makes you afraid? How does knowing God is your light help?

  2. David wanted one thing most of all. If you could ask God for one thing, what would it be, and why?

Memory Verse

“One thing I have asked of Yahweh, that I will seek after: that I may dwell in Yahweh’s house all the days of my life, to see Yahweh’s beauty, and to inquire in his temple.”

Psalms 27:4 (WEB)

Copy It

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • When have you felt far from God, and what helped?
  • Where do you feel closest to God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 27 · Grade 5

Seek His Face and Wait

Name Date

Read and Think

Psalm 27's title says it is By David. It holds two moods side by side: fearless confidence and earnest prayer. It opens with two questions that expect the answer no one: Yahweh is my light and my salvation. Whom shall I fear? Yahweh is the strength of my life. Of whom shall I be afraid? When evildoers came against him, they stumbled and fell. Though an army should encamp against me, my heart shall not fear.

At the center is David's single desire: One thing I have asked of Yahweh, that I will seek after: that I may dwell in Yahweh's house all the days of my life, to see Yahweh's beauty, and to inquire in his temple. His greatest longing is not safety but God himself. Yet safety follows, since in the day of trouble God will keep him secretly in his pavilion and lift him up on a rock.

The second half sounds different. David pleads, Hear, Yahweh, when I cry with my voice. He recalls God's invitation and his reply: When you said, Seek my face, my heart said to you, I will seek your face, Yahweh. He asks God not to hide his face, and he trusts that even if his father and mother forsake him, Yahweh will take him up. False witnesses rise against him, but he is confident: I will see the goodness of Yahweh in the land of the living. The final verse speaks to the reader: Wait for Yahweh. Be strong, and let your heart take courage. Yes, wait for Yahweh.

Show What You Know

  1. What two moods does Psalm 27 hold?

  2. What is David's single desire?

  3. What does David say his heart answered God's invitation?

  4. What is David confident he will see?

Crossword

43512

Across

  1. Of whom shall I be ____.
  2. To see Yahweh’s ____.
  3. Yahweh is the ____ of my life.

Down

  1. Yahweh is my ____ and my salvation.
  2. And to inquire in his ____.

Think About It

  1. Psalm 27 says to wait for Yahweh. Why is waiting on God sometimes hard, and how can you be strong while you wait?

  2. God invites us to seek his face. What are practical ways you can seek God's face this week?

Memory Verse

“One thing I have asked of Yahweh, that I will seek after: that I may dwell in Yahweh’s house all the days of my life, to see Yahweh’s beauty, and to inquire in his temple.”

Psalms 27:4 (WEB)

Copy It

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • David told himself to be strong and let his heart take courage. How can you speak truth to your own heart when you are discouraged?
  • Who could you encourage who is going through a scary time?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.