The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 17

For teachers and parents. Prints separately from the student sheets.

Psalms 17 · For teachers and parents

Answer Key: Under the Shadow of Your Wings

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolUnder God's Wings

birdEyeheartperson

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenSafe with God

WINGS → picture 3EYE → picture 1PRAY → picture 4LOVE → picture 2

Grade 1God Keeps Me Safe

David asked God to hear him. → picture 4His feet did not slip. → picture 3Keep me as the apple of your eye. → picture 1Hide me under your wings. → picture 5I shall see your face. → picture 2

Order:

1. Hear, Yahweh, my righteous plea2. I have called on you3. Keep me as the apple of your eye4. I shall see your face in righteousness

Grade 2The Apple of God's Eye

  1. What kind of psalm does the title say this is? A Prayer by David (circle)
  2. Why did David call on God? Because God would answer him
  3. What did David ask God to keep him as? The apple of his eye
  4. Where did David ask God to hide him? Under the shadow of his wings
  5. What will David see? God's face (circle)
FAAVFLNKSAYGPPCBUHCKPATHSLAECTEYELIDBPRAYERPOPGJJUAHSWOSUBWINGSSBGYJCIVNPSTEPSVYP

Grade 3Hide Me Under Your Wings

  1. What does David ask Yahweh to hear? His righteous plea
  2. What have David's steps held fast to? God's paths
  3. What does David ask God to show? His marvelous loving kindness
  4. Where does David ask to be hidden? Under the shadow of God's wings
  5. What will David see in righteousness? God's face
1: Hear, Yahweh, my righteous plea2: I have called on you3: Keep me as the apple of your eye4: I shall see your face in righteousness
PRAYERYCGFTDWERKNKDFHIWGLNHESWNDLIPSKTEGECMCAYEYSHADOWKPEFACEKCGSIBYFJAAOOVJPATHS

Grade 4The Apple of Your Eye

  1. What kind of lips does David's prayer not come from? Deceitful lips
  2. What does the apple of the eye mean? Something very precious that is carefully protected
  3. What does David compare his enemies to? A hungry lion
  4. What will satisfy David? Seeing God's form when he awakes

Word bank: 1. God; 2. steps; 3. eye; 4. wings

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Hidden in the Shadow of His Wings

  1. What does David invite God to do? Examine his heart
  2. What is the apple of the eye? The pupil, which we protect instantly
  3. How are men of the world described? Their portion is in this life.
  4. What is David's deepest satisfaction? Seeing God's face, God himself
3PATH4S2PRYER1LIS5EYTEPS

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.