The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 17

Every grade prints starting on a new page. No answers are included.

Psalms 17 · Preschool

Under God's Wings

Name Date

Color the bird and its wings. God keeps us safe like a bird keeps its babies under its wings.

Can you find these in the picture? Circle each one!

Bible Verse

“I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.”

Psalms 17:6 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: A mother bird keeps her babies safe under her wings. God keeps us safe too. Let's hug ourselves and say, God keeps me safe!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 17 · Kindergarten

Safe with God

Name Date

Trace the Words

Trace each word with your pencil.

WINGS
SAFE
EYE
PRAY
I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.

Psalms 17:6 (WEB)

Match the Pictures

Draw a line from each word to its picture.

WINGS
EYE
PRAY
LOVE

Mini Maze

Help find the way through the maze.

Draw It

Draw a bird covering its babies with its wings.

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God keep us safe?
  • Who is like a mother bird?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 17 · Grade 1

God Keeps Me Safe

Name Date

Trace the Words

Trace the words and the verse.

PRAY
PATHS
WINGS
FACE
I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.

Psalms 17:6 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

David asked God to hear him.
His feet did not slip.
Keep me as the apple of your eye.
Hide me under your wings.
I shall see your face.

Under Your Wings

Write the number 1 to 4 in each circle to show the right order.

I shall see your face in righteousness

Keep me as the apple of your eye

Hear, Yahweh, my righteous plea

I have called on you

Draw a bird covering its babies with its wings.

Memory Verse

“I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.”

Psalms 17:6 (WEB)

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where do you feel safe with God?
  • How can you pray when you are afraid?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 17 · Grade 2

The Apple of God's Eye

Name Date

Read the Story

The title says this is a Prayer by David. David asked Yahweh to hear his prayer. He said, I have called on you, for you will answer me, God.

David asked God, Keep me as the apple of your eye. Hide me under the shadow of your wings. Like a bird keeps her babies safe, God kept David safe. David said, I shall see your face.

Memory Verse

“I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.”

Psalms 17:6 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What kind of psalm does the title say this is?

    The apple of his eyeGod's faceA Prayer by David

  2. Why did David call on God?

  3. What did David ask God to keep him as?

  4. Where did David ask God to hide him?

  5. What will David see?

    A Prayer by DavidGod's faceThe apple of his eye

Word Search

Find and circle each word. Words go across and down.

FAAVFLNKSAYGPPCBUHCKPATHSLAECTEYELIDBPRAYERPOPGJJUAHSWOSUBWINGSSBGYJCIVNPSTEPSVYP
  • PRAYER
  • SHADOW
  • STEPS
  • PATHS
  • WINGS
  • LIPS
  • FACE
  • EYE

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does it feel to know you are very special to God?
  • David begged to be heard. How can you listen when others talk to you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 17 · Grade 3

Hide Me Under Your Wings

Name Date

Read the Story

The title says this is a Prayer by David. David asks, Hear, Yahweh, my righteous plea. He says his steps have held fast to God's paths, and his feet have not slipped. He says, I have called on you, for you will answer me, God.

David asks God to show his marvelous loving kindness. He prays, Keep me as the apple of your eye. Hide me under the shadow of your wings. Wicked people were all around him. But David ends with hope: As for me, I shall see your face in righteousness.

Memory Verse

“I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.”

Psalms 17:6 (WEB)

Answer the Questions

  1. What does David ask Yahweh to hear?

  2. What have David's steps held fast to?

  3. What does David ask God to show?

  4. Where does David ask to be hidden?

  5. What will David see in righteousness?

Under Your Wings

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

PRAYERYCGFTDWERKNKDFHIWGLNHESWNDLIPSKTEGECMCAYEYSHADOWKPEFACEKCGSIBYFJAAOOVJPATHS
  • PRAYER
  • SHADOW
  • STEPS
  • PATHS
  • WINGS
  • LIPS
  • FACE
  • EYE

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • The singer asked God to look at his heart. How can you check if your heart pleases God?
  • David chose not to speak bad words. How can you watch what you say?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 17 · Grade 4

The Apple of Your Eye

Name Date

Read and Think

Psalm 17's title says it is a Prayer by David. David asks Yahweh to hear his righteous plea, a prayer that doesn't go out of deceitful lips. God has tested his heart and visited him in the night. David says, My steps have held fast to your paths. My feet have not slipped. He calls on God because he is sure God will answer.

David asks God to show his marvelous loving kindness and save those who take refuge in him. He prays, Keep me as the apple of your eye. Hide me under the shadow of your wings. The apple of the eye is something very precious that is carefully protected. His enemies were proud and surrounded him like a hungry lion, so he asks God to rescue him. The psalm ends, I shall be satisfied, when I awake, with seeing your form.

Show What You Know

  1. What kind of lips does David's prayer not come from?

  2. What does the apple of the eye mean?

  3. What does David compare his enemies to?

  4. What will satisfy David?

Word Bank Fill-In

Use the word bank to fill in each blank.

Godstepswingseye
  1. has tested his heart and visited him in the night.
  2. David says, My have held fast to your paths.
  3. He prays, Keep me as the apple of your .
  4. Hide me under the shadow of your .

Think About It

  1. David pictured God hiding him under his wings. When do you need to feel God's protection?

  2. You are precious to God like the apple of his eye. How should that change the way you see yourself?

Memory Verse

“I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.”

Psalms 17:6 (WEB)

Copy It

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • David's feet had not slipped from God's paths. What helps you keep walking with God when it is hard?
  • How does it change your day to know God treasures you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 17 · Grade 5

Hidden in the Shadow of His Wings

Name Date

Read and Think

Psalm 17's title says it is a Prayer by David. David begins with an appeal for justice: Hear, Yahweh, my righteous plea. Give ear to my prayer that doesn't go out of deceitful lips. He invites God to examine him: You have proved my heart. You have visited me in the night. He is not claiming to be sinless, but he is honest that he has kept himself from the ways of the violent and that his feet have not slipped from God's paths.

Then he pleads for protection with two tender pictures: Keep me as the apple of your eye. Hide me under the shadow of your wings. The apple of the eye is the pupil, which we protect instantly, and the wings recall a bird sheltering its young. His enemies have callous hearts, speak proudly, and are like a lion lurking in secret places, so he asks Yahweh to arise, confront them, and deliver his soul.

The ending contrasts two kinds of people. The men of the world have their portion in this life. David's hope is different: As for me, I shall see your face in righteousness. I shall be satisfied, when I awake, with seeing your form. His deepest satisfaction is not wealth or safety but God himself.

Show What You Know

  1. What does David invite God to do?

  2. What is the apple of the eye?

  3. How are men of the world described?

  4. What is David's deepest satisfaction?

Crossword

34215

Across

  1. By the word of your ____.
  2. My steps have held fast to your ____.
  3. Keep me as the apple of your ____.

Down

  1. A ____ by David.
  2. My ____ have held fast to your paths.

Think About It

  1. David asked God to examine his heart. What might God find if he examined yours today?

  2. The men of the world have their portion in this life. What would it look like for God to be your greatest treasure?

Memory Verse

“As for me, I shall see your face in righteousness. I shall be satisfied, when I awake, with seeing your form.”

Psalms 17:15 (WEB)

Copy It

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • David prayed with confidence that God would answer. What makes your prayers bold or timid?
  • What do you hope for more than things of this world?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.