The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 17

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 17 · Grade 3

Hide Me Under Your Wings

Name Date

Read the Story

The title says this is a Prayer by David. David asks, Hear, Yahweh, my righteous plea. He says his steps have held fast to God's paths, and his feet have not slipped. He says, I have called on you, for you will answer me, God.

David asks God to show his marvelous loving kindness. He prays, Keep me as the apple of your eye. Hide me under the shadow of your wings. Wicked people were all around him. But David ends with hope: As for me, I shall see your face in righteousness.

Memory Verse

“I have called on you, for you will answer me, God. Turn your ear to me. Hear my speech.”

Psalms 17:6 (WEB)

Answer the Questions

  1. What does David ask Yahweh to hear?

  2. What have David's steps held fast to?

  3. What does David ask God to show?

  4. Where does David ask to be hidden?

  5. What will David see in righteousness?

Under Your Wings

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

PRAYERYCGFTDWERKNKDFHIWGLNHESWNDLIPSKTEGECMCAYEYSHADOWKPEFACEKCGSIBYFJAAOOVJPATHS
  • PRAYER
  • SHADOW
  • STEPS
  • PATHS
  • WINGS
  • LIPS
  • FACE
  • EYE

Prayer

Dear God, thank You for hiding me under Your wings. Help me . Amen.

Take It Home

For families: talk about these together.

  • The singer asked God to look at his heart. How can you check if your heart pleases God?
  • David chose not to speak bad words. How can you watch what you say?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.