The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 138

For teachers and parents. Prints separately from the student sheets.

Psalms 138 · For teachers and parents

Answer Key: I Will Give Thanks with My Whole Heart

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Answered Me

heartcrownsunhand

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenThank You, God

THANKS → picture 4HEART → picture 3CALLED → picture 2STRONG → picture 1

Grade 1Whole Heart

I will give you thanks with my whole heart. → picture 3I will bow toward your holy temple. → picture 5In the day that I called, you answered me. → picture 2All the kings of the earth will give you thanks. → picture 4Your right hand will save me. → picture 1

Order:

1. For you have exalted your Name and your Word above all2. You encouraged me with strength in my soul3. You will stretch out your hand against the wrath of my enemies4. Don’t forsake the works of your own hands

Grade 2Thank You with All My Heart

  1. Whose name is in the title of Psalm 138? David (circle)
  2. How does David thank God? With his whole heart (circle)
  3. What did God do when David called? He answered him. (circle)
  4. Whom does God care for? Small and humble people (circle)
  5. What does God finish? What he starts (circle)
OPGMJDTSFDIITRTRJDSTRENGTHWNYFWIYYEBAPMKIHFAAMEVFRWORDETHANKSTBBBCHANDDIMWTEMPLEG

Grade 3God Answers and Revives

  1. How does David give thanks? With his whole heart
  2. What did God give David when he called? Strength in his soul
  3. Who will give thanks to Yahweh one day? All the kings of the earth
  4. Whom does Yahweh look after? The lowly
  5. What will God do when David walks in trouble? Revive him
1: For you have exalted your Name and your Word above all2: You encouraged me with strength in my soul3: You will stretch out your hand against the wrath of my enemies4: Don’t forsake the works of your own hands
JKRBCFEJFVSRTWWORDNOTTEKIBWHMBRHMMYGAROHEAPRYNWONENNLRDDRAWAGKEFCRMPGRTSIYDENDMTH

Grade 4Whole-Hearted Thanks

  1. Where does David praise God openly? Before the gods, where other gods are honored
  2. What did God's answer give David inside? Strength and courage in his soul
  3. What surprising truth does verse 6 teach? The high God looks after the lowly.
  4. What is David confident God will do? Fulfill that which concerns him

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The High God Who Cares for the Lowly

  1. Which psalms form the final group with David's name? Psalms 138 to 145
  2. What effect did answered prayer have on David? God encouraged him with strength in his soul.
  3. What paradox does verse 6 hold? The high God looks after the lowly but knows the proud from afar.
  4. Which New Testament verse matches David's final confidence? Philippians 1:6
3NAME2TEPLE1THAKS5HART4WOD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.