The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 138

Every grade prints starting on a new page. No answers are included.

Psalms 138 · Preschool

God Answered Me

Name Date

Color the person praying and the light. God answers when we call!

Can you find these in the picture? Circle each one!

Bible Verse

“In the day that I called, you answered me. You encouraged me with strength in my soul.”

Psalms 138:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: David called to God, and God answered him and made him strong. Let's flex our muscles and say, God makes me strong!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 138 · Kindergarten

Thank You, God

Name Date

Trace the Words

Trace each word with your pencil.

THANKS
HEART
CALLED
STRONG
In the day that I called, you answered me. You encouraged me with strength in my soul.

Psalms 138:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

THANKS
HEART
CALLED
STRONG

Mini Maze

Help find the way through the maze.

Draw It

Draw your whole heart praising God.

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does David thank God?
  • What did God do when David called?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 138 · Grade 1

Whole Heart

Name Date

Trace the Words

Trace the words and the verse.

THANKS
ANSWERED
STRENGTH
LOWLY
In the day that I called, you answered me. You encouraged me with strength in my soul.

Psalms 138:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

I will give you thanks with my whole heart.
I will bow toward your holy temple.
In the day that I called, you answered me.
All the kings of the earth will give you thanks.
Your right hand will save me.

Whole-Hearted Thanks

Write the number 1 to 4 in each circle to show the right order.

You will stretch out your hand against the wrath of my enemies

Don’t forsake the works of your own hands

You encouraged me with strength in my soul

For you have exalted your Name and your Word above all

Draw your whole heart praising God.

Memory Verse

“In the day that I called, you answered me. You encouraged me with strength in my soul.”

Psalms 138:3 (WEB)

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who does God care for?
  • What can you tell God you are glad about?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 138 · Grade 2

Thank You with All My Heart

Name Date

Read the Story

The title of Psalm 138 says it is by David. He thanks God with his whole heart.

When David called to God, God answered him. God made him strong inside. God is very great, but he cares for small and humble people. When David was in trouble, God helped him. God finishes what he starts.

Memory Verse

“In the day that I called, you answered me. You encouraged me with strength in my soul.”

Psalms 138:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Whose name is in the title of Psalm 138?

    Small and humble peopleWith his whole heartDavid

  2. How does David thank God?

    DavidHe answered himWith his whole heart

  3. What did God do when David called?

    He answered himWith his whole heartWhat he starts

  4. Whom does God care for?

    Small and humble peopleDavidHe answered him

  5. What does God finish?

    With his whole heartHe answered himWhat he starts

Word Search

Find and circle each word. Words go across and down.

OPGMJDTSFDIITRTRJDSTRENGTHWNYFWIYYEBAPMKIHFAAMEVFRWORDETHANKSTBBBCHANDDIMWTEMPLEG
  • STRENGTH
  • THANKS
  • TEMPLE
  • HEART
  • NAME
  • WORD
  • HAND

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • God's love lasts forever. What can you sing about God's love?
  • What will the kings of the earth do?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 138 · Grade 3

God Answers and Revives

Name Date

Read the Story

Psalm 138 is titled By David. I will give you thanks with my whole heart. David bows toward God's holy temple and thanks him for his loving kindness and truth.

In the day that I called, you answered me. You encouraged me with strength in my soul. One day all the kings of the earth will give thanks to Yahweh.

For though Yahweh is high, yet he looks after the lowly. Though I walk in the middle of trouble, you will revive me. Yahweh will fulfill that which concerns me.

Memory Verse

“In the day that I called, you answered me. You encouraged me with strength in my soul.”

Psalms 138:3 (WEB)

Answer the Questions

  1. How does David give thanks?

  2. What did God give David when he called?

  3. Who will give thanks to Yahweh one day?

  4. Whom does Yahweh look after?

  5. What will God do when David walks in trouble?

Whole-Hearted Thanks

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

JKRBCFEJFVSRTWWORDNOTTEKIBWHMBRHMMYGAROHEAPRYNWONENNLRDDRAWAGKEFCRMPGRTSIYDENDMTH
  • STRENGTH
  • THANKS
  • TEMPLE
  • HEART
  • NAME
  • WORD
  • HAND

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • God keeps His promises to David. What promise from God do you remember?
  • What does God finish?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 138 · Grade 4

Whole-Hearted Thanks

Name Date

Read and Think

Psalm 138 is titled By David. It begins with full-hearted praise: I will give you thanks with my whole heart. Before the gods, I will sing praises to you. David praises Yahweh openly, even where other gods are honored. He bows toward God's holy temple, thankful for God's loving kindness and truth.

The reason is personal: In the day that I called, you answered me. You encouraged me with strength in my soul. God's answer was not only a change in David's situation but courage inside him. David expects that all the kings of the earth will one day give thanks, for they have heard the words of your mouth.

Then comes a surprising truth: For though Yahweh is high, yet he looks after the lowly; but he knows the proud from afar. David finishes with confidence: Though I walk in the middle of trouble, you will revive me. Yahweh will fulfill that which concerns me. Your loving kindness, Yahweh, endures forever.

Show What You Know

  1. Where does David praise God openly?

  2. What did God's answer give David inside?

  3. What surprising truth does verse 6 teach?

  4. What is David confident God will do?

Think About It

  1. God answered David with strength inside. When has God given you courage even before a problem was solved?

  2. Yahweh will fulfill that which concerns me. What are you trusting God to finish in your life?

Memory Verse

“Yahweh will fulfill that which concerns me. Your loving kindness, Yahweh, endures forever. Don’t forsake the works of your own hands.”

Psalms 138:8 (WEB)

Copy It

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does wholehearted mean?
  • How can you care for someone who feels small?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 138 · Grade 5

The High God Who Cares for the Lowly

Name Date

Read and Think

Psalm 138 is titled By David. It opens a final group of eight psalms with David's name in their titles (138 to 145). I will give you thanks with my whole heart. Before the gods, I will sing praises to you. David's worship is wholehearted and public, a witness that Yahweh alone deserves praise.

David thanks God for his loving kindness and for his truth, for you have exalted your Name and your Word above all. The turning point is answered prayer: In the day that I called, you answered me. You encouraged me with strength in my soul. David then looks outward. All the kings of the earth will give you thanks, Yahweh, for they have heard the words of your mouth.

Verse 6 holds a key paradox: For though Yahweh is high, yet he looks after the lowly; but he knows the proud from afar. Greatness and tenderness belong together in God. The psalm ends with trust for the future: Though I walk in the middle of trouble, you will revive me. Yahweh will fulfill that which concerns me. Don't forsake the works of your own hands. In the New Testament, Paul is confident that he who began a good work in you will complete it (Philippians 1:6).

Show What You Know

  1. Which psalms form the final group with David's name?

  2. What effect did answered prayer have on David?

  3. What paradox does verse 6 hold?

  4. Which New Testament verse matches David's final confidence?

Crossword

32154

Across

  1. For you have exalted your ____ and your Word above all.
  2. I will give you thanks with my whole ____.

Down

  1. I will give you ____ with my whole heart.
  2. I will bow down toward your holy ____.
  3. For you have exalted your Name and your ____ above all.

Think About It

  1. God is high yet looks after the lowly. How does that comfort you when you feel small?

  2. David asks God not to forsake the works of his hands. How can you trust that God will finish his work in you?

Memory Verse

“Yahweh will fulfill that which concerns me. Your loving kindness, Yahweh, endures forever. Don’t forsake the works of your own hands.”

Psalms 138:8 (WEB)

Copy It

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you stay humble before God?
  • How does Philippians 1:6 connect to Psalm 138?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.