The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 138

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 138 · Grade 3

God Answers and Revives

Name Date

Read the Story

Psalm 138 is titled By David. I will give you thanks with my whole heart. David bows toward God's holy temple and thanks him for his loving kindness and truth.

In the day that I called, you answered me. You encouraged me with strength in my soul. One day all the kings of the earth will give thanks to Yahweh.

For though Yahweh is high, yet he looks after the lowly. Though I walk in the middle of trouble, you will revive me. Yahweh will fulfill that which concerns me.

Memory Verse

“In the day that I called, you answered me. You encouraged me with strength in my soul.”

Psalms 138:3 (WEB)

Answer the Questions

  1. How does David give thanks?

  2. What did God give David when he called?

  3. Who will give thanks to Yahweh one day?

  4. Whom does Yahweh look after?

  5. What will God do when David walks in trouble?

Whole-Hearted Thanks

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

JKRBCFEJFVSRTWWORDNOTTEKIBWHMBRHMMYGAROHEAPRYNWONENNLRDDRAWAGKEFCRMPGRTSIYDENDMTH
  • STRENGTH
  • THANKS
  • TEMPLE
  • HEART
  • NAME
  • WORD
  • HAND

Prayer

Dear God, thank You for answering me. Help me . Amen.

Take It Home

For families: talk about these together.

  • God keeps His promises to David. What promise from God do you remember?
  • What does God finish?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.