The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 124

For teachers and parents. Prints separately from the student sheets.

Psalms 124 · For teachers and parents

Answer Key: God Was on Our Side

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolLike a Free Bird

birdwavesheartsun

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Helps

BIRD → picture 2FREE → picture 4HELP → picture 1SIDE → picture 3

Grade 1Our Help

Yahweh was on our side. → picture 2The waters would have overwhelmed us. → picture 4Our soul has escaped like a bird. → picture 5The snare is broken. → picture 1Our help is in Yahweh's name. → picture 3

Order:

1. The waters would have overwhelmed us2. Our soul has escaped like a bird out of the fowler’s snare3. Our help is in Yahweh’s name

Grade 2God Is on Our Side

  1. Whose name is in the title of Psalm 124? David (circle)
  2. Whose side was God on? Their side (circle)
  3. What were they like? A bird caught in a trap
  4. What happened to the trap? It broke. (circle)
  5. Where is our help? In Yahweh's name (circle)
OTUBIRDMLEEJVKTDELFESCAPEDVHHOWATERSDEEMMSHFONVAAIFENSVLGVRSLAPILNVETPMLTUKUMNHER

Grade 3Escaped Like a Bird

  1. What does the psalm ask Israel to imagine? What would happen if Yahweh had not been on their side
  2. What two dangers would have come? Enemies and a flood of water
  3. What is a fowler? A bird hunter
  4. What happened to the snare? It was broken.
  5. Who made heaven and earth? Yahweh
1: The waters would have overwhelmed us2: Our soul has escaped like a bird out of the fowler’s snare3: Our help is in Yahweh’s name
WOBIRDDKJAHDGFDFWHTDEARTHIEEHIGAUJVLREFJDCARPSAESCAPEDTVDNAMEEFPEEYDEWLMUNLCOJOYF

Grade 4If God Had Not Been with Us

  1. Who is invited to say the psalm? All Israel
  2. What picture shows the size of the danger? A flood of proud waters
  3. Who broke the snare? God
  4. What is the psalm's closing confession? Our help is in Yahweh's name, who made heaven and earth.

Word bank: 1. God; 2. waters; 3. escaped; 4. bird

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Remembering Rescue

  1. What is a corporate thanksgiving? A song of thanks by the whole people together
  2. Why does the psalm use if it had not been? To make people feel how close they came to disaster and deepen gratitude
  3. What would the proud waters have done? Gone over their soul
  4. What does the escaped bird show about salvation? The escape is God's work, not the bird's.
4ESCAPED1WATRS3NME2BIR5HLP

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.