The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 124

Every grade prints starting on a new page. No answers are included.

Psalms 124 · Preschool

Like a Free Bird

Name Date

Color the bird flying free. God helped his people escape!

Can you find these in the picture? Circle each one!

Bible Verse

“Our soul has escaped like a bird out of the fowler’s snare. The snare is broken, and we have escaped.”

Psalms 124:7 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: The bird was caught in a trap, but the trap broke and the bird flew away! God helps his people like that. Let's flap our wings and fly!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 124 · Kindergarten

God Helps

Name Date

Trace the Words

Trace each word with your pencil.

BIRD
FREE
HELP
SIDE
Our help is in Yahweh’s name, who made heaven and earth.

Psalms 124:8 (WEB)

Match the Pictures

Draw a line from each word to its picture.

BIRD
FREE
HELP
SIDE

Mini Maze

Help find the way through the maze.

Draw It

Draw a bird flying free.

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who helps you when you are stuck?
  • Who is on your team?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 124 · Grade 1

Our Help

Name Date

Trace the Words

Trace the words and the verse.

SIDE
WATERS
BIRD
HELP
Our help is in Yahweh’s name, who made heaven and earth.

Psalms 124:8 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Yahweh was on our side.
The waters would have overwhelmed us.
Our soul has escaped like a bird.
The snare is broken.
Our help is in Yahweh's name.

Our Help Is in His Name

Write the number 1 to 3 in each circle to show the right order.

Our help is in Yahweh’s name

The waters would have overwhelmed us

Our soul has escaped like a bird out of the fowler’s snare

Draw a bird flying free.

Memory Verse

“Our help is in Yahweh’s name, who made heaven and earth.”

Psalms 124:8 (WEB)

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where does our help come from?
  • Who made heaven and earth?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 124 · Grade 2

God Is on Our Side

Name Date

Read the Story

The title of Psalm 124 calls it A Song of Ascents by David. He asks what would have happened if Yahweh had not been on our side. Things would have been very bad.

But God was on their side! God helped them get away. They were like a bird caught in a trap. Then the trap broke, and the bird flew free. David says, our help is in Yahweh's name. He made heaven and earth.

Memory Verse

“Our help is in Yahweh’s name, who made heaven and earth.”

Psalms 124:8 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Whose name is in the title of Psalm 124?

    A bird caught in a trapTheir sideDavid

  2. Whose side was God on?

    In Yahweh's nameA bird caught in a trapTheir side

  3. What were they like?

  4. What happened to the trap?

    Their sideIt brokeDavid

  5. Where is our help?

    It brokeIn Yahweh's nameA bird caught in a trap

Word Search

Find and circle each word. Words go across and down.

OTUBIRDMLEEJVKTDELFESCAPEDVHHOWATERSDEEMMSHFONVAAIFENSVLGVRSLAPILNVETPMLTUKUMNHER
  • ESCAPED
  • WATERS
  • HEAVEN
  • EARTH
  • HELP
  • NAME
  • BIRD

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is a fowler?
  • What did God break?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 124 · Grade 3

Escaped Like a Bird

Name Date

Read the Story

Psalm 124 is titled A Song of Ascents. By David. It asks Israel to imagine: If it had not been Yahweh who was on our side, what would have happened?

Enemies would have swallowed them up. A flood of water would have gone over their soul. But Yahweh did not let that happen. Blessed be Yahweh!

Our soul has escaped like a bird out of the fowler's snare. A fowler is a bird hunter. The snare is broken, and we have escaped. Our help is in Yahweh's name, who made heaven and earth.

Memory Verse

“Our help is in Yahweh’s name, who made heaven and earth.”

Psalms 124:8 (WEB)

Answer the Questions

  1. What does the psalm ask Israel to imagine?

  2. What two dangers would have come?

  3. What is a fowler?

  4. What happened to the snare?

  5. Who made heaven and earth?

Our Help Is in His Name

Write what happened in each box.

1
2
3

Word Search

Find each word. Words go across, down, and diagonally.

WOBIRDDKJAHDGFDFWHTDEARTHIEEHIGAUJVLREFJDCARPSAESCAPEDTVDNAMEEFPEEYDEWLMUNLCOJOYF
  • ESCAPED
  • WATERS
  • HEAVEN
  • EARTH
  • HELP
  • NAME
  • BIRD

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • When has God helped you get out of trouble?
  • How does God help you when you feel stuck?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 124 · Grade 4

If God Had Not Been with Us

Name Date

Read and Think

Psalm 124 is titled A Song of Ascents. By David. It invites the whole people to join in: let Israel now say. The psalm asks them to imagine their history without God. If it had not been Yahweh who was on our side, when men rose up against us, then they would have swallowed us up alive.

David uses a flood picture. The waters would have overwhelmed us, the stream would have gone over our soul. Then the proud waters would have gone over our soul. The danger was real and too big for them to escape alone.

But God acted. Blessed be Yahweh, who has not given us as a prey to their teeth. Our soul has escaped like a bird out of the fowler's snare. The snare is broken, and we have escaped. The bird did not break the trap; God did. The psalm ends with confession of faith: Our help is in Yahweh's name, who made heaven and earth.

Show What You Know

  1. Who is invited to say the psalm?

  2. What picture shows the size of the danger?

  3. Who broke the snare?

  4. What is the psalm's closing confession?

Word Bank Fill-In

Use the word bank to fill in each blank.

watersGodescapedbird
  1. The psalm asks them to imagine their history without .
  2. The would have overwhelmed us, the stream would have gone over our soul.
  3. The snare is broken, and we have .
  4. The did not break the trap; God did.

Think About It

  1. The psalm asks, what if God had not been on our side? How would your life be different without God's help?

  2. The bird did not break the snare; God did. What problem can you trust God to break for you?

Memory Verse

“Our help is in Yahweh’s name, who made heaven and earth.”

Psalms 124:8 (WEB)

Copy It

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you thank God for a time He rescued you?
  • God did not give His people as prey to their enemies' teeth. How can thankfulness for God's protection grow in you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 124 · Grade 5

Remembering Rescue

Name Date

Read and Think

Psalm 124 is titled A Song of Ascents. By David. It is a song of corporate thanksgiving: let Israel now say. The first five verses use a hypothetical, if it had not been Yahweh who was on our side, to make the people feel how close they came to disaster. Remembering what could have happened makes gratitude deeper.

Two images describe the danger. First, enemies would have swallowed them up alive. Second, the waters would have overwhelmed them, and the proud waters would have gone over their soul. Both pictures show danger beyond human strength.

Then the psalm turns to praise. Blessed be Yahweh, who has not given us as a prey to their teeth. A new picture appears: a small bird caught in a hunter's net, helpless until the snare is broken. The escape is God's work, not the bird's. The final verse became a well-known confession in Christian worship: Our help is in Yahweh's name, who made heaven and earth.

Show What You Know

  1. What is a corporate thanksgiving?

  2. Why does the psalm use if it had not been?

  3. What would the proud waters have done?

  4. What does the escaped bird show about salvation?

Crossword

41325

Across

  1. Our soul has ____ like a bird out of the fowler’s snare.
  2. Our ____ is in Yahweh’s name.

Down

  1. Then the ____ would have overwhelmed us.
  2. Our soul has escaped like a ____ out of the fowler’s snare.
  3. Our help is in Yahweh’s ____.

Think About It

  1. Imagining life without God's help can deepen thankfulness. What danger has God kept you from?

  2. Our help is in Yahweh's name. How can you say that truth with others this week?

Memory Verse

“Our help is in Yahweh’s name, who made heaven and earth.”

Psalms 124:8 (WEB)

Copy It

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who broke the snare in the psalm?
  • How can you tell others what God has done for you?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.