The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 124

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 124 · Grade 3

Escaped Like a Bird

Name Date

Read the Story

Psalm 124 is titled A Song of Ascents. By David. It asks Israel to imagine: If it had not been Yahweh who was on our side, what would have happened?

Enemies would have swallowed them up. A flood of water would have gone over their soul. But Yahweh did not let that happen. Blessed be Yahweh!

Our soul has escaped like a bird out of the fowler's snare. A fowler is a bird hunter. The snare is broken, and we have escaped. Our help is in Yahweh's name, who made heaven and earth.

Memory Verse

“Our help is in Yahweh’s name, who made heaven and earth.”

Psalms 124:8 (WEB)

Answer the Questions

  1. What does the psalm ask Israel to imagine?

  2. What two dangers would have come?

  3. What is a fowler?

  4. What happened to the snare?

  5. Who made heaven and earth?

Our Help Is in His Name

Write what happened in each box.

1
2
3

Word Search

Find each word. Words go across, down, and diagonally.

WOBIRDDKJAHDGFDFWHTDEARTHIEEHIGAUJVLREFJDCARPSAESCAPEDTVDNAMEEFPEEYDEWLMUNLCOJOYF
  • ESCAPED
  • WATERS
  • HEAVEN
  • EARTH
  • HELP
  • NAME
  • BIRD

Prayer

Dear God, thank You for being on our side. Help me . Amen.

Take It Home

For families: talk about these together.

  • When has God helped you get out of trouble?
  • How does God help you when you feel stuck?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.